• Gene id: 26052

Gene Summary

• Gene Symbol: DNM3   Gene   UCSC   Ensembl
• Aliases: Dyna III
• Gene name: dynamin 3
• Alternate names: dynamin-3, T-dynamin, dynamin family member, dynamin, testicular,
• Gene location: 1q24.3 (146021821: 146017467)     Exons: 4     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of a family of guanosine triphosphate (GTP)-binding proteins that associate with microtubules and are involved in vesicular transport. The encoded protein functions in the development of megakaryocytes. Alternative splicing resu
• OMIM: 611445

Protein Summary

• Protein general information: Q9UQ16  
  • Name: Dynamin 3 (EC 3.6.5.5) (Dynamin, testicular) (T dynamin)
  • Length: 869  
  • Mass: 97746
• Sequence:

  MGNREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVT
  SKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPP
  DIEYQIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLL
  PLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKL
  QGQLLSIEHEVEAYKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGAKINRIFHERFPFEIV
  KMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKLKGPSLKSVDLVIQELINTVKKCTKKLANFP
  RLCEETERIVANHIREREGKTKDQVLLLIDIQVSYINTNHEDFIGFANAQQRSSQVHKKTTVGNQGTNLPPSRQI
  VIRKGWLTISNIGIMKGGSKGYWFVLTAESLSWYKDDEEKEKKYMLPLDNLKVRDVEKSFMSSKHIFALFNTEQR
  NVYKDYRFLELACDSQEDVDSWKASLLRAGVYPDKSVAENDENGQAENFSMDPQLERQVETIRNLVDSYMSIINK
  CIRDLIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLMEESAEQAQRRDEMLRMYQALKEALGIIGDISTATV
  STPAPPPVDDSWIQHSRRSPPPSPTTQRRPTLSAPLARPTSGRGPAPAIPSPGPHSGAPPVPFRPGPLPPFPSSS
  DSFGAPPQVPSRPTRAPPSVPSRRPPPSPTRPTIIRPLESSLLD

• Structural information:
  • Protein Domains: (28..29-)
    (/note="Dynamin-type-G)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01055-)
    (515..62-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (659..75-)
    (/note="GED-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00720"-)
  • Interpro: IPR000375  IPR001401  IPR019762  IPR022812  IPR030381   IPR003130  IPR020850  IPR027417  IPR011993  IPR001849  
  • Prosite: PS00410 PS51718 PS51388 PS50003
  • CDD: cd08771
  • PDB: 3L43 5A3F
  • PDBsum: 3L43 5A3F
  • DIP: 36244
  • STRING: ENSP00000356705
• Other Databases: GeneCards:  DNM3  Malacards:  DNM3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000266	mitochondrial fission	IBA	biological process
GO:0003924	GTPase activity	IBA	molecular function
GO:0008017	microtubule binding	IBA	molecular function
GO:0015630	microtubule cytoskeleton	IBA	cellular component
GO:0016185	synaptic vesicle budding from presynaptic endocytic zone membrane	IBA	biological process
GO:0030424	axon	IBA	cellular component
GO:0031410	cytoplasmic vesicle	IBA	cellular component
GO:0050803	regulation of synapse structure or activity	IBA	biological process
GO:0061025	membrane fusion	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0014069	postsynaptic density	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0031623	receptor internalization	IBA	biological process
GO:0031966	mitochondrial membrane	IBA	cellular component
GO:0043197	dendritic spine	IBA	cellular component
GO:0044327	dendritic spine head	IBA	cellular component
GO:0045202	synapse	IBA	cellular component
GO:0045211	postsynaptic membrane	IBA	cellular component
GO:0048285	organelle fission	IBA	biological process
GO:0098844	postsynaptic endocytic zone membrane	IBA	cellular component
GO:0098884	postsynaptic neurotransmitter receptor internalization	IBA	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0061002	negative regulation of dendritic spine morphogenesis	IEA	biological process
GO:0051491	positive regulation of filopodium assembly	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0043083	synaptic cleft	IEA	cellular component
GO:0031798	type 1 metabotropic glutamate receptor binding	IEA	molecular function
GO:0030424	axon	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0003924	GTPase activity	IEA	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0061828	apical tubulobulbar complex	IEA	cellular component
GO:0016185	synaptic vesicle budding from presynaptic endocytic zone membrane	IEA	biological process
GO:0061001	regulation of dendritic spine morphogenesis	IEA	biological process
GO:0050998	nitric-oxide synthase binding	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0044327	dendritic spine head	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0031802	type 5 metabotropic glutamate receptor binding	IEA	molecular function
GO:0014069	postsynaptic density	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:1903423	positive regulation of synaptic vesicle recycling	IEA	biological process
GO:0099186	structural constituent of postsynapse	IEA	molecular function
GO:0098884	postsynaptic neurotransmitter receptor internalization	IEA	biological process
GO:0098844	postsynaptic endocytic zone membrane	IEA	cellular component
GO:0061829	basal tubulobulbar complex	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0048488	synaptic vesicle endocytosis	IEA	biological process
GO:0001917	photoreceptor inner segment	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0099173	postsynapse organization	IEA	biological process
GO:0043197	dendritic spine	ISS	cellular component
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0003924	GTPase activity	ISS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0046847	filopodium assembly	ISS	biological process
GO:0014069	postsynaptic density	ISS	cellular component
GO:0007416	synapse assembly	ISS	biological process
GO:0006897	endocytosis	ISS	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04072	Phospholipase D signaling pathway
hsa04721	Synaptic vesicle cycle
hsa05100	Bacterial invasion of epithelial cells
hsa04961	Endocrine and other factor-regulated calcium reabsorption

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R