• Gene id: 26051

Gene Summary

• Gene Symbol: PPP1R16B   Gene   UCSC   Ensembl
• Aliases: ANKRD4, TIMAP
• Gene name: protein phosphatase 1 regulatory subunit 16B
• Alternate names: protein phosphatase 1 regulatory inhibitor subunit 16B, CAAX box protein TIMAP, TGF-beta-inhibited membrane-associated protein, ankyrin repeat domain protein 4, ankyrin repeat domain-containing protein 4, hTIMAP, protein phosphatase 1, regulatory (inhibitor) su,
• Gene location: 20q11.23 (38805693: 38923023)     Exons: 12     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is membrane-associated and contains five ankyrin repeats, a protein phosphatase-1-interacting domain, and a carboxy-terminal CAAX box domain. Synthesis of the encoded protein is inhibited by transforming growth factor beta
• OMIM: 613275

Protein Summary

• Protein general information: Q96T49  
  • Name: Protein phosphatase 1 regulatory inhibitor subunit 16B (Ankyrin repeat domain containing protein 4) (CAAX box protein TIMAP) (TGF beta inhibited membrane associated protein) (hTIMAP)
  • Length: 567  
  • Mass: 63551
• Sequence:

  MASHVDLLTELQLLEKVPTLERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGRRKKVSFEASVALLEA
  SLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHAAATCGHINLV
  KILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRVAPEQQMIADIHCMIAAGQDLDWI
  DAQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMQMAELLVSHGASLSARTSMDEMPID
  LCEEEEFKVLLLELKHKHDVIMKSQLRHKSSLSRRTSSAGSRGKVVRRASLSDRTNLYRKEYEGEAILWQRSAAE
  DQRTSTYNGDIRETRTDQENKDPNPRLEKPVLLSEFPTKIPRGELDMPVENGLRAPVSAYQYALANGDVWKVHEV
  PDYSMAYGNPGVADATPPWSSYKEQSPQTLLELKRQRAAAKLLSHPFLSTHLGSSMARTGESSSEGKAPLIGGRT
  SPYSSNGTSVYYTVTSGDPPLLKFKAPIEEMEEKVHGCCRIS

• Structural information:
  • Interpro: IPR002110  IPR020683  IPR036770  IPR017417  
  • Prosite: PS50297 PS50088
  • STRING: ENSP00000299824
• Other Databases: GeneCards:  PPP1R16B  Malacards:  PPP1R16B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008157	protein phosphatase 1 binding	IBA	molecular function
GO:0035304	regulation of protein dephosphorylation	IBA	biological process
GO:0061028	establishment of endothelial barrier	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0017020	myosin phosphatase regulator activity	IBA	molecular function
GO:0019888	protein phosphatase regulator activity	IBA	molecular function
GO:1903670	regulation of sprouting angiogenesis	IBA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0035304	regulation of protein dephosphorylation	IMP	biological process
GO:0051489	regulation of filopodium assembly	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019888	protein phosphatase regulator activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061028	establishment of endothelial barrier	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0035307	positive regulation of protein dephosphorylation	IDA	biological process
GO:0035308	negative regulation of protein dephosphorylation	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0014066	regulation of phosphatidylinositol 3-kinase signaling	IMP	biological process
GO:0019888	protein phosphatase regulator activity	IDA	molecular function
GO:1903589	positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IMP	biological process
GO:1902309	negative regulation of peptidyl-serine dephosphorylation	IMP	biological process
GO:0042995	cell projection	IDA	cellular component
GO:0061028	establishment of endothelial barrier	IMP	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IMP	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881