• Gene id: 26027

Gene Summary

• Gene Symbol: ACOT11   Gene   UCSC   Ensembl
• Aliases: BFIT, STARD14, THEA, THEM1
• Gene name: acyl-CoA thioesterase 11
• Alternate names: acyl-coenzyme A thioesterase 11, START domain containing 14, StAR-related lipid transfer (START) domain containing 14, acyl-CoA thioester hydrolase 11, adipose-associated thioesterase, brown fat-inducible thioesterase, palmitoyl-coenzyme A thioesterase, thioeste,
• Gene location: 1p32.3 (54548227: 54639191)     Exons: 18     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the acyl-CoA thioesterase family which catalyse the conversion of activated fatty acids to the corresponding non-esterified fatty acid and coenzyme A. Expression of a mouse homolog in brown adipose tissue is induced by low te
• OMIM: 613306

Protein Summary

• Protein general information: Q8WXI4  
  • Name: Acyl coenzyme A thioesterase 11 (Acyl CoA thioesterase 11) (EC 3.1.2. ) (Acyl CoA thioester hydrolase 11) (Adipose associated thioesterase) (Brown fat inducible thioesterase) (BFIT) (Palmitoyl coenzyme A thioesterase) (EC 3.1.2.2)
  • Length: 607  
  • Mass: 68492
  • Tissue specificity: Isoform 1 is predominantly expressed in skeletal muscle, liver, testis, stomach, spleen, lung and brain. Isoform 2 is predominantly expressed in kidney, uterus, hibernoma and white adipose tissue.
• Sequence:

  MIQNVGNHLRRGLASVFSNRTSRKSALRAGNDSAMADGEGYRNPTEVQMSQLVLPCHTNQRGELSVGQLLKWIDT
  TACLSAERHAGCPCVTASMDDIYFEHTISVGQVVNIKAKVNRAFNSSMEVGIQVASEDLCSEKQWNVCKALATFV
  ARREITKVKLKQITPRTEEEKMEHSVAAERRRMRLVYADTIKDLLANCAIQGDLESRDCSRMVPAEKTRVESVEL
  VLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTLKAIEMFHFRGPSQVGDRLVLKAIVNNAFKHSMEVGV
  CVEAYRQEAETHRRHINSAFMTFVVLDADDQPQLLPWIRPQPGDGERRYREASARKKIRLDRKYIVSCKQTEVPL
  SVPWDPSNQVYLSYNNVSSLKMLVAKDNWVLSSEISQVRLYTLEDDKFLSFHMEMVVHVDAAQAFLLLSDLRQRP
  EWDKHYRSVELVQQVDEDDAIYHVTSPALGGHTKPQDFVILASRRKPCDNGDPYVIALRSVTLPTHRETPEYRRG
  ETLCSGFCLWREGDQLTKCCWVRVSLTELVSASGFYSWGLESRSKGRRSDGWNGKLAGGHLSTLKAIPVAKINSR
  FGYLQDT

• Structural information:
  • Protein Domains: (43..15-)
    1 (/note="HotDog-ACOT-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01106-)
    (216..32-)
    2 (/note="HotDog-ACOT-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01106-)
    (375..58-)
    (/note="START-)
    (/evidence="ECO:0000255|PROSI-)
  • Interpro: IPR040170  IPR033120  IPR029069  IPR023393  IPR002913   IPR006683  
  • Prosite: PS51770 PS50848
  • PDB: 3FO5
  • PDBsum: 3FO5
  • STRING: ENSP00000360366
• Other Databases: GeneCards:  ACOT11  Malacards:  ACOT11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0047617	acyl-CoA hydrolase activity	IBA	molecular function
GO:0006637	acyl-CoA metabolic process	IBA	biological process
GO:0006631	fatty acid metabolic process	IBA	biological process
GO:0036042	long-chain fatty acyl-CoA binding	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0000062	fatty-acyl-CoA binding	IBA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0016790	thiolester hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0052689	carboxylic ester hydrolase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0102991	myristoyl-CoA hydrolase activity	IEA	molecular function
GO:0016290	palmitoyl-CoA hydrolase activity	IEA	molecular function
GO:0006637	acyl-CoA metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0009409	response to cold	ISS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	ISS	biological process
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0035556	intracellular signal transduction	NAS	biological process
GO:0047617	acyl-CoA hydrolase activity	TAS	molecular function
GO:0006631	fatty acid metabolic process	NAS	biological process
GO:0009266	response to temperature stimulus	ISS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq