• Gene id: 26017

Gene Summary

• Gene Symbol: FAM32A   Gene   UCSC   Ensembl
• Aliases: OTAG-12, OTAG12
• Gene name: family with sequence similarity 32 member A
• Alternate names: protein FAM32A, ovarian tumor associated gene-12,
• Gene location: 19p13.11 (16185183: 16192045)     Exons: 4     NC_000019.10
• OMIM: 604190

Protein Summary

• Protein general information: Q9Y421  
  • Name: Protein FAM32A (Ovarian tumor associated gene 12) (OTAG 12)
  • Length: 112  
  • Mass: 13178
  • Tissue specificity: Expressed in ovary, with isoform 1 being predominant. {ECO
• Sequence:

  MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQME
  RILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK

• Structural information:
  • Interpro: IPR013865  
  • PDB: 6QDV
  • PDBsum: 6QDV
  • STRING: ENSP00000263384
• Other Databases: GeneCards:  FAM32A  Malacards:  FAM32A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005730	nucleolus	IBA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881