• Gene id: 26010

Gene Summary

• Gene Symbol: SPATS2L   Gene   UCSC   Ensembl
• Aliases: DNAPTP6, SGNP
• Gene name: spermatogenesis associated serine rich 2 like
• Alternate names: SPATS2-like protein, DNA polymerase-transactivated protein 6, stress granule and nucleolar protein,
• Gene location: 2q33.1 (200305878: 200482263)     Exons: 21     NC_000002.12
• OMIM: 613817

Protein Summary

• Protein general information: Q9NUQ6  
  • Name: SPATS2 like protein (DNA polymerase transactivated protein 6) (Stress granule and nucleolar protein) (SGNP)
  • Length: 558  
  • Mass: 61729
• Sequence:

  MAELNTHVNVKEKIYAVRSVVPNKSNNEIVLVLQQFDFNVDKAVQAFVDGSAIQVLKEWNMTGKKKNNKRKRSKS
  KQHQGNKDAKDKVERPEAGPLQPQPPQIQNGPMNGCEKDSSSTDSANEKPALIPREKKISILEEPSKALRGVTEG
  NRLLQQKLSLDGNPKPIHGTTERSDGLQWSAEQPCNPSKPKAKTSPVKSNTPAAHLEIKPDELAKKRGPNIEKSV
  KDLQRCTVSLTRYRVMIKEEVDSSVKKIKAAFAELHNCIIDKEVSLMAEMDKVKEEAMEILTARQKKAEELKRLT
  DLASQMAEMQLAELRAEIKHFVSERKYDEELGKAARFSCDIEQLKAQIMLCGEITHPKNNYSSRTPCSSLLPLLN
  AHAATSGKQSNFSRKSSTHNKPSEGKAANPKMVSSLPSTADPSHQTMPANKQNGSSNQRRRFNPQYHNNRLNGPA
  KSQGSGNEAEPLGKGNSRHEHRRQPHNGFRPKNKGGAKNQEASLGMKTPEAPAHSEKPRRRQHAADTSEARPFRG
  SVGRVSQCNLCPTRIEVSTDAAVLSVPAVTLVA

• Structural information:
  • Interpro: IPR009816  IPR009060  
  • STRING: ENSP00000482515
• Other Databases: GeneCards:  SPATS2L  Malacards:  SPATS2L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq