• Gene id: 26007

Gene Summary

• Gene Symbol: TKFC   Gene   UCSC   Ensembl
• Aliases: DAK, NET45, TKFCD
• Gene name: triokinase and FMN cyclase
• Alternate names: triokinase/FMN cyclase, ATP-dependent dihydroxyacetone kinase, DHA kinase, Dha kinase/FMN cyclase, FAD-AMP lyase cyclic FMN forming, FAD-AMP lyase cyclizing, bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing), dihydroxyacetone kinase 2 ,
• Gene location: 11q12.2 (28259257: 28241696)     Exons: 7     NC_000006.12
• Gene summary(Entrez): This gene is a member of the family of dihydroxyacetone kinases, which have a protein structure distinct from other kinases. The product of this gene phosphorylates dihydroxyacetone, and also catalyzes the formation of riboflavin 4',5'-phosphate (aka cycl
• OMIM: 615844

Protein Summary

• Protein general information: Q3LXA3  
  • Name: Triokinase/FMN cyclase (Bifunctional ATP dependent dihydroxyacetone kinase/FAD AMP lyase (cyclizing)) [Includes: ATP dependent dihydroxyacetone kinase (DHA kinase) (EC 2.7.1.28) (EC 2.7.1.29) (Glycerone kinase) (Triokinase) (Triose kinase); FAD AMP lyase
  • Length: 575  
  • Mass: 58947
  • Tissue specificity: Detected in erythrocytes (at protein level). {ECO
• Sequence:

  MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVALLSGGGSGHEPAHAGFIGKGMLTGV
  IAGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGLAREQARAEGIPVEMVVIGDDSAFTVLKKAG
  RRGLCGTVLIHKVAGALAEAGVGLEEIAKQVNVVAKAMGTLGVSLSSCSVPGSKPTFELSADEVELGLGIHGEAG
  VRRIKMATADEIVKLMLDHMTNTTNASHVPVQPGSSVVMMVNNLGGLSFLELGIIADATVRSLEGRGVKIARALV
  GTFMSALEMPGISLTLLLVDEPLLKLIDAETTAAAWPNVAAVSITGRKRSRVAPAEPQEAPDSTAAGGSASKRMA
  LVLERVCSTLLGLEEHLNALDRAAGDGDCGTTHSRAARAIQEWLKEGPPPASPAQLLSKLSVLLLEKMGGSSGAL
  YGLFLTAAAQPLKAKTSLPAWSAAMDAGLEAMQKYGKAAPGDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVK
  SAEAAAEATKNMEAGAGRASYISSARLEQPDPGAVAAAAILRAILEVLQS

• Structural information:
  • Protein Domains: (9..33-)
    (/note="DhaK-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00814-)
    (372..57-)
    (/note="DhaL-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00813"-)
  • Interpro: IPR012734  IPR004006  IPR004007  IPR036117  
  • Prosite: PS51481 PS51480
  • DIP: 60967
  • STRING: ENSP00000378360
• Other Databases: GeneCards:  TKFC  Malacards:  TKFC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004371	glycerone kinase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0019563	glycerol catabolic process	IBA	biological process
GO:0039534	negative regulation of MDA-5 signaling pathway	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004371	glycerone kinase activity	IEA	molecular function
GO:0006071	glycerol metabolic process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0016829	lyase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0034012	FAD-AMP lyase (cyclizing) activity	IEA	molecular function
GO:0004371	glycerone kinase activity	IEA	molecular function
GO:0050354	triokinase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0045087	innate immune response	TAS	biological process
GO:0061624	fructose catabolic process to hydroxyacetone phosphate and glyceraldehyde-3-phosphate	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050354	triokinase activity	IEA	molecular function
GO:0004371	glycerone kinase activity	IDA	molecular function
GO:0050354	triokinase activity	IDA	molecular function
GO:0046835	carbohydrate phosphorylation	IDA	biological process
GO:0045088	regulation of innate immune response	IDA	biological process
GO:0044262	cellular carbohydrate metabolic process	IDA	biological process
GO:0044262	cellular carbohydrate metabolic process	IDA	biological process
GO:0034012	FAD-AMP lyase (cyclizing) activity	IDA	molecular function
GO:0004371	glycerone kinase activity	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005634	nucleus	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa00561	Glycerolipid metabolism
hsa04622	RIG-I-like receptor signaling pathway
hsa00051	Fructose and mannose metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq