• Gene id: 25999

Gene Summary

• Gene Symbol: CLIP3   Gene   UCSC   Ensembl
• Aliases: CLIPR-59, CLIPR59, RSNL1
• Gene name: CAP-Gly domain containing linker protein 3
• Alternate names: CAP-Gly domain-containing linker protein 3, CLIP-170-related 59 kDa protein, cytoplasmic linker protein 170-related 59 kDa protein, restin-like 1,
• Gene location: 19q13.12 (36032872: 36014659)     Exons: 14     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the cytoplasmic linker protein 170 family. Members of this protein family contain a cytoskeleton-associated protein glycine-rich domain and mediate the interaction of microtubules with cellular organelles. The encoded protein

Protein Summary

• Protein general information: Q96DZ5  
  • Name: CAP Gly domain containing linker protein 3 (Cytoplasmic linker protein 170 related 59 kDa protein) (CLIP 170 related 59 kDa protein) (CLIPR 59)
  • Length: 547  
  • Mass: 59560
• Sequence:

  MTKTDPAPMAPPPRGEEEEEEEEDEPVPEAPSPTQERRQKPVVHPSAPAPLPKDYAFTFFDPNDPACQEILFDPQ
  TTIPELFAIVRQWVPQVQHKIDVIGNEILRRGCHVNDRDGLTDMTLLHYACKAGAHGVGDPAAAVRLSQQLLALG
  ADVTLRSRWTNMNALHYAAYFDVPDLVRVLLKGARPRVVNSTCSDFNHGSALHIAASSLCLGAAKCLLEHGANPA
  LRNRKGQVPAEVVPDPMDMSLDKAEAALVAKELRTLLEEAVPLSCALPKVTLPNYDNVPGNLMLSALGLRLGDRV
  LLDGQKTGTLRFCGTTEFASGQWVGVELDEPEGKNDGSVGGVRYFICPPKQGLFASVSKISKAVDAPPSSVTSTP
  RTPRMDFSRVTGKGRREHKGKKKTPSSPSLGSLQQRDGAKAEVGDQVLVAGQKQGIVRFYGKTDFAPGYWYGIEL
  DQPTGKHDGSVFGVRYFTCPPRHGVFAPASRIQRIGGSTDSPGDSVGAKKVHQVTMTQPKRTFTTVRTPKDIASE
  NSISRLLFCCWFPWMLRAEMQS

• Structural information:
  • Protein Domains: (314..35-)
    (/note="CAP-Gly-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00045-)
    (436..47-)
    (/note="CAP-Gly-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00045"-)
  • Interpro: IPR002110  IPR020683  IPR036770  IPR036859  IPR000938  
  • Prosite: PS50297 PS50088 PS00845 PS50245
  • PDB: 2CP0
  • PDBsum: 2CP0
  • STRING: ENSP00000353732
• Other Databases: GeneCards:  CLIP3  Malacards:  CLIP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031122	cytoplasmic microtubule organization	IBA	biological process
GO:0005938	cell cortex	IBA	cellular component
GO:0051010	microtubule plus-end binding	IBA	molecular function
GO:0035371	microtubule plus-end	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0010803	regulation of tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005802	trans-Golgi network	IEA	cellular component
GO:0010828	positive regulation of glucose transmembrane transport	IEA	biological process
GO:0045444	fat cell differentiation	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:1903078	positive regulation of protein localization to plasma membrane	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005795	Golgi stack	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0055038	recycling endosome membrane	IDA	cellular component
GO:0035594	ganglioside binding	IDA	molecular function
GO:0008017	microtubule binding	IDA	molecular function
GO:0045121	membrane raft	IDA	cellular component
GO:0032588	trans-Golgi network membrane	IDA	cellular component
GO:0031901	early endosome membrane	IDA	cellular component
GO:1903078	positive regulation of protein localization to plasma membrane	ISS	biological process
GO:0045807	positive regulation of endocytosis	IMP	biological process
GO:0045444	fat cell differentiation	ISS	biological process
GO:0032588	trans-Golgi network membrane	IMP	cellular component
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IMP	biological process
GO:0010828	positive regulation of glucose transmembrane transport	ISS	biological process
GO:0072321	chaperone-mediated protein transport	IMP	biological process
GO:0044091	membrane biogenesis	IMP	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0005886	plasma membrane	IMP	cellular component
GO:0001934	positive regulation of protein phosphorylation	ISS	biological process
GO:0031115	negative regulation of microtubule polymerization	IMP	biological process
GO:0008017	microtubule binding	IMP	molecular function
GO:0005802	trans-Golgi network	ISS	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray