• Gene id: 25996

Gene Summary

• Gene Symbol: REXO2   Gene   UCSC   Ensembl
• Aliases: CGI-114, REX2, RFN, SFN
• Gene name: RNA exonuclease 2
• Alternate names: oligoribonuclease, mitochondrial, REX2, RNA exonuclease 2 homolog, RNA exonuclease 2 homolog, small fragment nuclease,
• Gene location: 11q23.2 (12349513: 12835544)     Exons: 18     NC_000010.11
• Gene summary(Entrez): This gene encodes a 3'-to-5' exonuclease specific for small (primarily 5 nucleotides or less in length) single-stranded RNA and DNA oligomers. This protein may have a role in DNA repair, replication, and recombination, and in RNA processing and degradatio
• OMIM: 607149

Protein Summary

• Protein general information: Q9Y3B8  
  • Name: Oligoribonuclease, mitochondrial (EC 3.1. . ) (RNA exonuclease 2 homolog) (Small fragment nuclease)
  • Length: 237  
  • Mass: 26833
• Sequence:

  MLGGSLGSRLLRGVGGSHGRFGARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNIL
  AEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKF
  LDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKIDEKKRK
  IIENGENEKTVS

• Structural information:
  • Protein Domains: (43..20-)
    (/note="Exonuclease"-)
  • Interpro: IPR013520  IPR022894  IPR012337  IPR036397  
  • CDD: cd06135
  • PDB: 6J7Y 6J7Z 6J80 6N6I 6N6J 6N6K 6RCI 6RCL 6RCN
  • PDBsum: 6J7Y 6J7Z 6J80 6N6I 6N6J 6N6K 6RCI 6RCL 6RCN
  • STRING: ENSP00000265881
• Other Databases: GeneCards:  REXO2  Malacards:  REXO2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0000175	3'-5'-exoribonuclease activity	IBA	molecular function
GO:0000175	3'-5'-exoribonuclease activity	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004527	exonuclease activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008408	3'-5' exonuclease activity	TAS	molecular function
GO:0009117	nucleotide metabolic process	TAS	biological process
GO:0008408	3'-5' exonuclease activity	IDA	molecular function
GO:0006139	nucleobase-containing compound metabolic process	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881