• Gene id: 25989

Gene Summary

• Gene Symbol: ULK3   Gene   UCSC   Ensembl
• Gene name: unc-51 like kinase 3
• Alternate names: serine/threonine-protein kinase ULK3,
• Gene location: 15q24.1 (74843165: 74836117)     Exons: 23     NC_000015.10
• OMIM: 613472

Protein Summary

• Protein general information: Q6PHR2  
  • Name: Serine/threonine protein kinase ULK3 (EC 2.7.11.1) (Unc 51 like kinase 3)
  • Length: 472  
  • Mass: 53444
  • Tissue specificity: Widely expressed. Highest levels observed in fetal brain. In adult tissues, high levels in brain, liver and kidney, moderate levels in testis and adrenal gland and low levels in heart, lung, stomach, thymus, prostate and placenta. In t
• Sequence:

  MAGPGWGPPRLDGFILTERLGSGTYATVYKAYAKKDTREVVAIKCVAKKSLNKASVENLLTEIEILKGIRHPHIV
  QLKDFQWDSDNIYLIMEFCAGGDLSRFIHTRRILPEKVARVFMQQLASALQFLHERNISHLDLKPQNILLSSLEK
  PHLKLADFGFAQHMSPWDEKHVLRGSPLYMAPEMVCQRQYDARVDLWSMGVILYEALFGQPPFASRSFSELEEKI
  RSNRVIELPLRPLLSRDCRDLLQRLLERDPSRRISFQDFFAHPWVDLEHMPSGESLGRATALVVQAVKKDQEGDS
  AAALSLYCKALDFFVPALHYEVDAQRKEAIKAKVGQYVSRAEELKAIVSSSNQALLRQGTSARDLLREMARDKPR
  LLAALEVASAAMAKEEAAGGEQDALDLYQHSLGELLLLLAAEPPGRRRELLHTEVQNLMARAEYLKEQVKMRESR
  WEADTLDKEGLSESVRSSCTLQ

• Structural information:
  • Protein Domains: (14..27-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (280..34-)
    (/note="MIT-1)
    (375..44-)
    (/note="MIT-2")
  • Interpro: IPR011009  IPR007330  IPR036181  IPR000719  IPR017441   IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 4WZX 6FDY 6FDZ
  • PDBsum: 4WZX 6FDY 6FDZ
  • STRING: ENSP00000400312
• Other Databases: GeneCards:  ULK3  Malacards:  ULK3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0072537	fibroblast activation	IMP	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0045880	positive regulation of smoothened signaling pathway	IDA	biological process
GO:0045880	positive regulation of smoothened signaling pathway	IDA	biological process
GO:0045879	negative regulation of smoothened signaling pathway	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0000407	phagophore assembly site	TAS	cellular component
GO:0090398	cellular senescence	TAS	biological process
GO:0006914	autophagy	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0006914	autophagy	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)