• Gene id: 25983

Gene Summary

• Gene Symbol: NGDN   Gene   UCSC   Ensembl
• Aliases: C14orf120, CANu1, LCP5, NGD, lpd-2
• Gene name: neuroguidin
• Alternate names: neuroguidin, EIF4E-binding protein, centromere accumulated nuclear protein 1, eukaryotic initiation factor 4E and CPEB binding protein, neuroguidin, EIF4E binding protein,
• Gene location: 14q11.2 (23469702: 23478825)     Exons: 10     NC_000014.9
• Gene summary(Entrez): Neuroguidin is an EIF4E (MIM 133440)-binding protein that interacts with CPEB (MIM 607342) and functions as a translational regulatory protein during development of the vertebrate nervous system (Jung et al., 2006 [PubMed 16705177]).[supplied by OMIM, Mar
• OMIM: 610777

Protein Summary

• Protein general information: Q8NEJ9  
  • Name: Neuroguidin (Centromere accumulated nuclear protein 1) (CANu1) (EIF4E binding protein)
  • Length: 315  
  • Mass: 35894
• Sequence:

  MAALGVLESDLPSAVTLLKNLQEQVMAVTAQVKSLTQKVQAGAYPTEKGLSFLEVKDQLLLMYLMDLTHLILDKA
  SGGSLQGHDAVLRLVEIRTVLEKLRPLDQKLKYQIDKLIKTAVTGSLSENDPLRFKPHPSNMMSKLSSEDEEEDE
  AEDDQSEASGKKSVKGVSKKYVPPRLVPVHYDETEAEREKKRLERAKRRALSSSVIRELKEQYSDAPEEIRDARH
  PHVTRQSQEDQHRINYEESMMVRLSVSKREKGRRKRANVMSSQLHSLTHFSDISALTGGTVHLDEDQNPIKKRKK
  IPQKGRKKKGFRRRR

• Structural information:
  • Interpro: IPR007146  
  • STRING: ENSP00000386134
• Other Databases: GeneCards:  NGDN  Malacards:  NGDN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005730	nucleolus	IBA	cellular component
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA	biological process
GO:0032040	small-subunit processome	IBA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0006417	regulation of translation	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030424	axon	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030175	filopodium	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)