• Gene id: 25977

Gene Summary

• Gene Symbol: NECAP1   Gene   UCSC   Ensembl
• Aliases: EIEE21
• Gene name: NECAP endocytosis associated 1
• Alternate names: adaptin ear-binding coat-associated protein 1,
• Gene location: 12p13.31 (8082210: 8097880)     Exons: 8     NC_000012.12
• Gene summary(Entrez): This gene encodes a protein containing two characteristic WXXF motifs. The encoded protein localizes to clathrin-coated vesicles, where it binds components of the adapter protein complexes and aids in endocytosis. Loss of function of this gene results in
• OMIM: 613624

Protein Summary

• Protein general information: Q8NC96  
  • Name: Adaptin ear binding coat associated protein 1 (NECAP endocytosis associated protein 1) (NECAP 1)
  • Length: 275  
  • Mass: 29737
• Sequence:

  MATELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKTAYIKLEDKVSGELFAQAPVE
  QYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQESEISKESQEMDARPKLD
  LGFKEGQTIKLCIGNITNKKGGASKPRTARGGGLSLLPPPPGGKVTIPPPSSSVAISNHVTPPPIPKSNHGGSDA
  DILLDLDSPAPVTTPAPTPVSVSNDLWGDFSTASSSVPNQAPQPSNWVQF

• Structural information:
  • Interpro: IPR012466  IPR011993  
  • CDD: cd13228
  • PDB: 6RH5 6RH6
  • PDBsum: 6RH5 6RH6
  • STRING: ENSP00000341737
• Other Databases: GeneCards:  NECAP1  Malacards:  NECAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030125	clathrin vesicle coat	IBA	cellular component
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0006897	endocytosis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0061024	membrane organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0030125	clathrin vesicle coat	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0030665	clathrin-coated vesicle membrane	IEA	cellular component

Diseases

Associated diseases	References
Early infantile epileptic encephalopathy	KEGG:H00606
Early infantile epileptic encephalopathy	KEGG:H00606
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881