• Gene id: 25972

Gene Summary

• Gene Symbol: UNC50   Gene   UCSC   Ensembl
• Aliases: GMH1, HSD23, PDLs22, UNCL, URP
• Gene name: unc-50 inner nuclear membrane RNA binding protein
• Alternate names: protein unc-50 homolog, geal-6 membrane-associated high-copy suppressor 1, periodontal ligament-specific protein 22, protein GMH1 homolog, unc-50 related, unc-50-like protein, uncoordinated-like protein,
• Gene location: 2q11.2 (98608547: 98618514)     Exons: 6     NC_000002.12
• OMIM: 617826

Protein Summary

• Protein general information: Q53HI1  
  • Name: Protein unc 50 homolog (Periodontal ligament specific protein 22) (PDLs22) (Protein GMH1 homolog) (hGMH1) (Uncoordinated like protein)
  • Length: 259  
  • Mass: 30373
  • Tissue specificity: Present in periodontal ligament fibroblasts (at protein level). {ECO
• Sequence:

  MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKD
  QWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLIDCVGVGLLIATLMWFISNKYLVKRQSRDYD
  VEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVIL
  LYPFAPLILLYGLSLALGWNFTHTLCSFYKYRVK

• Structural information:
  • Interpro: IPR007881  
  • STRING: ENSP00000350409
• Other Databases: GeneCards:  UNC50  Malacards:  UNC50

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030173	integral component of Golgi membrane	IBA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005637	nuclear inner membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881