• Gene id: 2597

Gene Summary

• Gene Symbol: GAPDH   Gene   UCSC   Ensembl
• Aliases: G3PD, GAPD, HEL-S-162eP
• Gene name: glyceraldehyde-3-phosphate dehydrogenase
• Alternate names: glyceraldehyde-3-phosphate dehydrogenase, OCAS, p38 component, Oct1 coactivator in S phase, 38 Kd component, aging-associated gene 9 protein, epididymis secretory sperm binding protein Li 162eP, peptidyl-cysteine S-nitrosylase GAPDH,
• Gene location: 12p13.31 (6534516: 6538374)     Exons: 10     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the glyceraldehyde-3-phosphate dehydrogenase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. The product of this gene catal
• OMIM: 138400

Protein Summary

• Protein general information: P04406  
  • Name: Glyceraldehyde 3 phosphate dehydrogenase (GAPDH) (EC 1.2.1.12) (Peptidyl cysteine S nitrosylase GAPDH) (EC 2.6.99. )
  • Length: 335  
  • Mass: 36,053
• Sequence:

  MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPIT
  IFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNA
  SCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELN
  GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAG
  IALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE

• Structural information:
  • Interpro: IPR020831  IPR020830  IPR020829  IPR020828  IPR006424   IPR036291  
  • Prosite: PS00071
  • PDB: 1U8F 1ZNQ 2FEH 3GPD 4WNC 4WNI
  • PDBsum: 1U8F 1ZNQ 2FEH 3GPD 4WNC 4WNI
  • DIP: 32521
  • STRING: ENSP00000229239
• Other Databases: GeneCards:  GAPDH  Malacards:  GAPDH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000226	microtubule cytoskeleton organization	ISS	biological process
GO:0004365	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	ISS	molecular function
GO:0004365	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	EXP	molecular function
GO:0004365	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	NAS	molecular function
GO:0004365	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	NAS	molecular function
GO:0004365	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	EXP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005811	lipid particle	IDA	cellular component
GO:0005829	cytosol	ISS	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006094	gluconeogenesis	TAS	biological process
GO:0008017	microtubule binding	ISS	molecular function
GO:0015630	microtubule cytoskeleton	ISS	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0017148	negative regulation of translation	IMP	biological process
GO:0017148	negative regulation of translation	IDA	biological process
GO:0030529	intracellular ribonucleoprotein complex	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0035605	peptidyl-cysteine S-nitrosylase activity	ISS	molecular function
GO:0035606	peptidyl-cysteine S-trans-nitrosylation	ISS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0050661	NADP binding	IEA	molecular function
GO:0050821	protein stabilization	ISS	biological process
GO:0051287	NAD binding	IEA	molecular function
GO:0051402	neuron apoptotic process	ISS	biological process
GO:0061621	canonical glycolysis	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071346	cellular response to interferon-gamma	IDA	biological process
GO:0097452	GAIT complex	IDA	cellular component
GO:0097452	GAIT complex	IDA	cellular component
GO:0000226	microtubule cytoskeleton organization	ISS	biological process
GO:0004365	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	IEA	molecular function
GO:0004365	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	ISS	molecular function
GO:0004365	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	EXP	molecular function
GO:0004365	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	NAS	molecular function
GO:0004365	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	NAS	molecular function
GO:0004365	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	EXP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005811	lipid particle	IDA	cellular component
GO:0005829	cytosol	ISS	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006006	glucose metabolic process	IEA	biological process
GO:0006094	gluconeogenesis	TAS	biological process
GO:0006096	glycolytic process	IEA	biological process
GO:0006096	glycolytic process	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0008017	microtubule binding	ISS	molecular function
GO:0015630	microtubule cytoskeleton	ISS	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016620	oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0017148	negative regulation of translation	IMP	biological process
GO:0017148	negative regulation of translation	IDA	biological process
GO:0030529	intracellular ribonucleoprotein complex	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0035605	peptidyl-cysteine S-nitrosylase activity	ISS	molecular function
GO:0035606	peptidyl-cysteine S-trans-nitrosylation	ISS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0050661	NADP binding	IEA	molecular function
GO:0050821	protein stabilization	ISS	biological process
GO:0051287	NAD binding	IEA	molecular function
GO:0051402	neuron apoptotic process	ISS	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0061621	canonical glycolysis	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071346	cellular response to interferon-gamma	IDA	biological process
GO:0097452	GAIT complex	IDA	cellular component
GO:0097452	GAIT complex	IDA	cellular component
GO:0000226	microtubule cytoskeleton organization	ISS	biological process
GO:0004365	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	ISS	molecular function
GO:0004365	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	EXP	molecular function
GO:0004365	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	NAS	molecular function
GO:0004365	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	NAS	molecular function
GO:0004365	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	EXP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005811	lipid particle	IDA	cellular component
GO:0005829	cytosol	ISS	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006094	gluconeogenesis	TAS	biological process
GO:0008017	microtubule binding	ISS	molecular function
GO:0015630	microtubule cytoskeleton	ISS	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0017148	negative regulation of translation	IMP	biological process
GO:0017148	negative regulation of translation	IDA	biological process
GO:0030529	intracellular ribonucleoprotein complex	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0035605	peptidyl-cysteine S-nitrosylase activity	ISS	molecular function
GO:0035606	peptidyl-cysteine S-trans-nitrosylation	ISS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0050821	protein stabilization	ISS	biological process
GO:0051402	neuron apoptotic process	ISS	biological process
GO:0061621	canonical glycolysis	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071346	cellular response to interferon-gamma	IDA	biological process
GO:0097452	GAIT complex	IDA	cellular component
GO:0097452	GAIT complex	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa01230	Biosynthesis of amino acids
hsa00010	Glycolysis / Gluconeogenesis
hsa04066	HIF-1 signaling pathway
hsa05010	Alzheimer disease
hsa05130	Pathogenic Escherichia coli infection

Diseases

Associated diseases	References
Alzheimer's disease	GAD: 18340469
Asthenozoospermia	MIK: 25825237
Male factor infertility	MIK: 25825237
Asthenozoospermia	MIK: 23455884
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenozoospermia	MIK: 25825237
Spermatogenic defects	MIK: 25926605
Asthenozoospermia	MIK: 25926605
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25825237	Asthenozoospermia				Male infertility	Tubulin beta 2B; glutathione S-transferase Mu 3; keratin type II cytoskeletal 1; outer dense fiber protein 2; voltage-dependent anion-selective channel protein 2; A-kinase anchor protein 4; cytochrome c oxidase subunit 6B; sperm protein associated with t
23455884	Idiopathic asthenozoospermia				Male infertility	GRP78 lactoferrin SPANXB PGK2 flagellin DJ-1 XPA binding protein 2 CAB2 GPX4 and GAPDH
25926605	Decreased sperm quality, Asthenozoospermia			60 (30 men with normal spermiograms, 30 men with asthenozoospermia)	Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881