• Gene id: 2596

Gene Summary

• Gene Symbol: GAP43   Gene   UCSC   Ensembl
• Aliases: B-50, GAP-43, PP46
• Gene name: growth associated protein 43
• Alternate names: neuromodulin, axonal membrane protein GAP-43, calmodulin-binding protein P-57, nerve growth-related peptide GAP43, neural phosphoprotein B-50, neuron growth-associated protein 43, protein F1,
• Gene location: 3q13.31 (115623509: 115721484)     Exons: 4     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective

Protein Summary

• Protein general information: P17677  
  • Name: Neuromodulin (Axonal membrane protein GAP 43) (Growth associated protein 43) (Neural phosphoprotein B 50) (pp46)
  • Length: 238  
  • Mass: 24803
• Sequence:

  MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVA
  DGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDN
  SPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDE
  GKEEEPEADQEHA

• Structural information:
  • Protein Domains: (31..6-)
    (/note="IQ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00116"-)
  • Interpro: IPR000048  IPR001422  IPR017454  IPR018947  IPR033137   IPR018243  
  • Prosite: PS50096 PS00412 PS00413
  • DIP: 452
  • STRING: ENSP00000377372
• Other Databases: GeneCards:  GAP43  Malacards:  GAP43

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901981	phosphatidylinositol phosphate binding	IBA	molecular function
GO:0035727	lysophosphatidic acid binding	IBA	molecular function
GO:0005516	calmodulin binding	IBA	molecular function
GO:0001786	phosphatidylserine binding	IBA	molecular function
GO:0042246	tissue regeneration	IBA	biological process
GO:0031103	axon regeneration	IBA	biological process
GO:0016198	axon choice point recognition	IBA	biological process
GO:0014069	postsynaptic density	IBA	cellular component
GO:0007399	nervous system development	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0051489	regulation of filopodium assembly	IDA	biological process
GO:0031527	filopodium membrane	IDA	cellular component
GO:0040008	regulation of growth	IEA	biological process
GO:0005516	calmodulin binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0040008	regulation of growth	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007205	protein kinase C-activating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0009611	response to wounding	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001786	phosphatidylserine binding	IEA	molecular function
GO:0035727	lysophosphatidic acid binding	IEA	molecular function
GO:0099150	regulation of postsynaptic specialization assembly	IEA	biological process
GO:1901981	phosphatidylinositol phosphate binding	IEA	molecular function
GO:0030424	axon	IEA	cellular component
GO:0045165	cell fate commitment	IEA	biological process
GO:0071944	cell periphery	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0042246	tissue regeneration	IEA	biological process
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007411	axon guidance	IEA	biological process
GO:0010001	glial cell differentiation	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0016198	axon choice point recognition	IEA	biological process
GO:0031527	filopodium membrane	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0032584	growth cone membrane	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray