• Gene id: 25946

Gene Summary

• Gene Symbol: ZNF385A   Gene   UCSC   Ensembl
• Aliases: HZF, RZF, ZFP385, ZNF385
• Gene name: zinc finger protein 385A
• Alternate names: zinc finger protein 385A, hematopoietic zinc finger protein, retinal zinc finger protein, zinc finger protein 385,
• Gene location: 12q13.13 (54391609: 54369133)     Exons: 11     NC_000012.12
• Gene summary(Entrez): Zinc finger proteins, such as ZNF385A, are regulatory proteins that act as transcription factors, bind single- or double-stranded RNA, or interact with other proteins (Sharma et al., 2004 [PubMed 15527981]).[supplied by OMIM, Oct 2008]
• OMIM: 609124

Protein Summary

• Protein general information: Q96PM9  
  • Name: Zinc finger protein 385A (Hematopoietic zinc finger protein) (Retinal zinc finger protein)
  • Length: 386  
  • Mass: 40454
  • Tissue specificity: Expressed predominantly in the retina. {ECO
• Sequence:

  MILGSLSRAGPLPLLRQPPIMQPPLDLKQILPFPLEPAPTLGLFSNYSTMDPVQKAVLSHTFGGPLLKTKRPVIS
  CNICQIRFNSQSQAEAHYKGNRHARRVKGIEAAKTRGREPGVREPGDPAPPGSTPTNGDGVAPRPVSMENGLGPA
  PGSPEKQPGSPSPPSIPETGQGVTKGEGGTPAPASLPGGSKEEEEKAKRLLYCALCKVAVNSLSQLEAHNKGTKH
  KTILEARSGLGPIKAYPRLGPPTPGEPEAPAQDRTFHCEICNVKVNSEVQLKQHISSRRHRDGVAGKPNPLLSRH
  KKSRGAGELAGTLTFSKELPKSLAGGLLPSPLAVAAVMAAAAGSPLSLRPAPAAPLLQGPPITHPLLHPAPGPIR
  TAHGPILFSPY

• Structural information:
  • Interpro: IPR003604  IPR036236  IPR013087  
  • STRING: ENSP00000338927
• Other Databases: GeneCards:  ZNF385A  Malacards:  ZNF385A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003730	mRNA 3'-UTR binding	IBA	molecular function
GO:0010609	mRNA localization resulting in posttranscriptional regulation of gene expression	IBA	biological process
GO:0043025	neuronal cell body	IBA	cellular component
GO:2000765	regulation of cytoplasmic translation	IBA	biological process
GO:0000790	nuclear chromatin	IDA	colocalizes with
GO:2000765	regulation of cytoplasmic translation	ISS	biological process
GO:1902164	positive regulation of DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator	IMP	biological process
GO:0045600	positive regulation of fat cell differentiation	ISS	biological process
GO:0030425	dendrite	ISS	cellular component
GO:0002039	p53 binding	IPI	molecular function
GO:1902166	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IMP	biological process
GO:0043025	neuronal cell body	ISS	cellular component
GO:0035855	megakaryocyte development	ISS	biological process
GO:0010609	mRNA localization resulting in posttranscriptional regulation of gene expression	ISS	biological process
GO:0006974	cellular response to DNA damage stimulus	ISS	biological process
GO:0006915	apoptotic process	ISS	biological process
GO:0003730	mRNA 3'-UTR binding	ISS	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0006417	regulation of translation	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:2000765	regulation of cytoplasmic translation	IEA	biological process
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030220	platelet formation	IEA	biological process
GO:0007626	locomotory behavior	IEA	biological process
GO:0007611	learning or memory	IEA	biological process
GO:0007599	hemostasis	IEA	biological process
GO:0070889	platelet alpha granule organization	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0035855	megakaryocyte development	IEA	biological process
GO:0010609	mRNA localization resulting in posttranscriptional regulation of gene expression	IEA	biological process
GO:0008298	intracellular mRNA localization	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0003730	mRNA 3'-UTR binding	IEA	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq