• Gene id: 25942

Gene Summary

• Gene Symbol: SIN3A   Gene   UCSC   Ensembl
• Aliases: WITKOS
• Gene name: SIN3 transcription regulator family member A
• Alternate names: paired amphipathic helix protein Sin3a, SIN3 homolog A, transcription regulator, histone deacetylase complex subunit Sin3a, transcriptional co-repressor Sin3A, transcriptional corepressor Sin3a, transcriptional regulator, SIN3A,
• Gene location: 15q24.2 (75455818: 75369378)     Exons: 27     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene is a transcriptional regulatory protein. It contains paired amphipathic helix (PAH) domains, which are important for protein-protein interactions and may mediate repression by the Mad-Max complex. [provided by RefSeq, Jul
• OMIM: 607776

Protein Summary

• Protein general information: Q96ST3  
  • Name: Paired amphipathic helix protein Sin3a (Histone deacetylase complex subunit Sin3a) (Transcriptional corepressor Sin3a)
  • Length: 1273  
  • Mass: 145,175
• Sequence:

  MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHG
  PAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDI
  MKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQ
  HPSQPSAQSAPAPAQPAPQPPPAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQ
  PVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSE
  FGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPSQNGCQIRRHPTGTTPPVKKKPKLLNLKDS
  SMADASKHGGGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYK
  ESVHLETYPKERATEGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSS
  KKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYAD
  KAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLL
  NEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLF
  AQRGDLSDVEEEEEEEMDVDEATGAVKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQ
  ILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNID
  SSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEICVQVTDLYLAENNNGATGGQLNTQNSRSLLESTY
  QRKAEQLMSDENCFKLMFIQSQGQVQLTIELLDTEEENSDDPVEAERWSDYVERYMNSDTTSPELREHLAQKPVF
  LPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVDSLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHE
  RVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGTVFKAP

• Structural information:
  • Protein Domains: PAH (119-189)
    PAH (300-383)
    PAH (456-525)
  • Interpro: IPR013194  IPR003822  IPR036600  IPR031693  IPR037969  
  • Prosite: PS51477
  • PDB: 1PO4
  • PDBsum: 1PO4
  • DIP: 31515
  • STRING: ENSP00000353622
• Other Databases: GeneCards:  SIN3A  Malacards:  SIN3A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0000976	transcription regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0001102	RNA polymerase II activating transcription factor binding	IPI	molecular function
GO:0001103	RNA polymerase II repressing transcription factor binding	IEA	molecular function
GO:0001106	RNA polymerase II transcription corepressor activity	IBA	molecular function
GO:0001701	in utero embryonic development	IEA	biological process
GO:0002218	activation of innate immune response	IMP	biological process
GO:0002230	positive regulation of defense response to virus by host	IMP	biological process
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005667	transcription factor complex	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006260	DNA replication	IEA	biological process
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006476	protein deacetylation	IMP	biological process
GO:0007568	aging	IEA	biological process
GO:0010817	regulation of hormone levels	IEA	biological process
GO:0010971	positive regulation of G2/M transition of mitotic cell cycle	IEA	biological process
GO:0016575	histone deacetylation	IBA	biological process
GO:0016580	Sin3 complex	IDA	cellular component
GO:0016580	Sin3 complex	IDA	cellular component
GO:0016580	Sin3 complex	NAS	cellular component
GO:0017053	transcriptional repressor complex	IEA	cellular component
GO:0031937	positive regulation of chromatin silencing	IMP	biological process
GO:0032403	protein complex binding	IEA	molecular function
GO:0033558	protein deacetylase activity	IMP	molecular function
GO:0034613	cellular protein localization	IEA	biological process
GO:0042754	negative regulation of circadian rhythm	ISS	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043619	regulation of transcription from RNA polymerase II promoter in response to oxidative stress	IEA	biological process
GO:0044255	cellular lipid metabolic process	TAS	biological process
GO:0045171	intercellular bridge	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0051595	response to methylglyoxal	IEA	biological process
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:1900181	negative regulation of protein localization to nucleus	IMP	biological process
GO:1901675	negative regulation of histone H3-K27 acetylation	IMP	biological process
GO:1903351	cellular response to dopamine	IEA	biological process
GO:2000678	negative regulation of transcription regulatory region DNA binding	IMP	biological process
GO:0004407	histone deacetylase activity	IBA	molecular function
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0000785	chromatin	IEA	cellular component
GO:0000976	transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0001102	RNA polymerase II activating transcription factor binding	IPI	molecular function
GO:0001103	RNA polymerase II repressing transcription factor binding	IEA	molecular function
GO:0001106	RNA polymerase II transcription corepressor activity	IEA	molecular function
GO:0001106	RNA polymerase II transcription corepressor activity	IBA	molecular function
GO:0001701	in utero embryonic development	IEA	biological process
GO:0002218	activation of innate immune response	IMP	biological process
GO:0002230	positive regulation of defense response to virus by host	IMP	biological process
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005667	transcription factor complex	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006260	DNA replication	IEA	biological process
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006476	protein deacetylation	IMP	biological process
GO:0007568	aging	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0010243	response to organonitrogen compound	IEA	biological process
GO:0010817	regulation of hormone levels	IEA	biological process
GO:0010971	positive regulation of G2/M transition of mitotic cell cycle	IEA	biological process
GO:0016575	histone deacetylation	IBA	biological process
GO:0016580	Sin3 complex	IDA	cellular component
GO:0016580	Sin3 complex	IDA	cellular component
GO:0016580	Sin3 complex	NAS	cellular component
GO:0017053	transcriptional repressor complex	IEA	cellular component
GO:0031937	positive regulation of chromatin silencing	IMP	biological process
GO:0032403	protein complex binding	IEA	molecular function
GO:0033558	protein deacetylase activity	IMP	molecular function
GO:0034613	cellular protein localization	IEA	biological process
GO:0042754	negative regulation of circadian rhythm	IEA	biological process
GO:0042754	negative regulation of circadian rhythm	ISS	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043234	protein complex	IEA	cellular component
GO:0043619	regulation of transcription from RNA polymerase II promoter in response to oxidative stress	IEA	biological process
GO:0044255	cellular lipid metabolic process	TAS	biological process
GO:0045171	intercellular bridge	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0051595	response to methylglyoxal	IEA	biological process
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:1900181	negative regulation of protein localization to nucleus	IMP	biological process
GO:1901675	negative regulation of histone H3-K27 acetylation	IMP	biological process
GO:1903351	cellular response to dopamine	IEA	biological process
GO:2000678	negative regulation of transcription regulatory region DNA binding	IMP	biological process
GO:0004407	histone deacetylase activity	IBA	molecular function
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0001102	RNA polymerase II activating transcription factor binding	IPI	molecular function
GO:0001106	RNA polymerase II transcription corepressor activity	IBA	molecular function
GO:0002218	activation of innate immune response	IMP	biological process
GO:0002230	positive regulation of defense response to virus by host	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006476	protein deacetylation	IMP	biological process
GO:0016575	histone deacetylation	IBA	biological process
GO:0016580	Sin3 complex	IDA	cellular component
GO:0016580	Sin3 complex	IDA	cellular component
GO:0016580	Sin3 complex	NAS	cellular component
GO:0031937	positive regulation of chromatin silencing	IMP	biological process
GO:0033558	protein deacetylase activity	IMP	molecular function
GO:0042754	negative regulation of circadian rhythm	ISS	biological process
GO:0044255	cellular lipid metabolic process	TAS	biological process
GO:0045171	intercellular bridge	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:1900181	negative regulation of protein localization to nucleus	IMP	biological process
GO:1901675	negative regulation of histone H3-K27 acetylation	IMP	biological process
GO:2000678	negative regulation of transcription regulatory region DNA binding	IMP	biological process
GO:0004407	histone deacetylase activity	IBA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04919	Thyroid hormone signaling pathway
hsa05202	Transcriptional misregulation in cancer
hsa05016	Huntington disease
hsa05169	Epstein-Barr virus infection

Diseases

Associated diseases	References
Azoospermia	MIK: 25395209
Witteveen-Kolk syndrome	OMIM: 607776
Azoospermia	MIK: 25395209
Cryptorchidism	MIK: 28606200
Role in differentiating spermatogonia	MIK: 23085237
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25395209	Azoospermia		Japanes e	80 Sertoli cell-only syndrome (SCOS)	Male infertility
23085237	Role in differentiating sermatogonia				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq