• Gene id: 25936

Gene Summary

• Gene Symbol: NSL1   Gene   UCSC   Ensembl
• Aliases: C1orf48, DC8, MIS14
• Gene name: NSL1 component of MIS12 kinetochore complex
• Alternate names: kinetochore-associated protein NSL1 homolog, NSL1, MIND kinetochore complex component, homolog, NSL1, MIS12 kinetochore complex component,
• Gene location: 1q32.3 (212798899: 212726152)     Exons: 10     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein with two coiled-coil domains that localizes to kinetochores, which are chromosome-associated structures that attach to microtubules and mediate chromosome movements during cell division. The encoded protein is part of a conserv
• OMIM: 609174

Protein Summary

• Protein general information: Q96IY1  
  • Name: Kinetochore associated protein NSL1 homolog
  • Length: 281  
  • Mass: 32162
• Sequence:

  MAGSPELVVLDPPWDKELAAGTESQALVSATPREDFRVRCTSKRAVTEMLQLCGRFVQKLGDALPEEIREPALRD
  AQWTFESAVQENISINGQAWQEASDNCFMDSDIKVLEDQFDEIIVDIATKRKQYPRKILECVIKTIKAKQEILKQ
  YHPVVHPLDLKYDPDPAPHMENLKCRGETVAKEISEAMKSLPALIEQGEGFSQVLRMQPVIHLQRIHQEVFSSCH
  RKPDAKPENFITQIETTPTETASRKTSDMVLKRKQTKDCPQRKWYPLRPKKINLDT

• Structural information:
  • Interpro: IPR013950  
  • PDB: 4NF9 5LSI 5LSJ 5LSK
  • PDBsum: 4NF9 5LSI 5LSJ 5LSK
  • STRING: ENSP00000355944
• Other Databases: GeneCards:  NSL1  Malacards:  NSL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000444	MIS12/MIND type complex	IBA	cellular component
GO:0000070	mitotic sister chromatid segregation	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000776	kinetochore	IEA	cellular component
GO:0000070	mitotic sister chromatid segregation	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0007059	chromosome segregation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0000777	condensed chromosome kinetochore	IDA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0000444	MIS12/MIND type complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)