• Gene id: 25932

Gene Summary

• Gene Symbol: CLIC4   Gene   UCSC   Ensembl
• Aliases: CLIC4L, H1, MTCLIC, huH1, p64H1
• Gene name: chloride intracellular channel 4
• Alternate names: chloride intracellular channel protein 4, chloride intracellular channel 4 like, epididymis secretory sperm binding protein, intracellular chloride ion channel protein p64H1,
• Gene location: 1p36.11 (24745446: 24844320)     Exons: 6     NC_000001.11
• Gene summary(Entrez): Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracel
• OMIM: 606536

Protein Summary

• Protein general information: Q9Y696  
  • Name: Chloride intracellular channel protein 4 (Intracellular chloride ion channel protein p64H1)
  • Length: 253  
  • Mass: 28772
  • Tissue specificity: Detected in epithelial cells from colon, esophagus and kidney (at protein level). Expression is prominent in heart, kidney, placenta and skeletal muscle. {ECO
• Sequence:

  MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHP
  PFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQK
  LDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAY
  SRDEFTNTCPSDKEVEIAYSDVAKRLTK

• Structural information:
  • Protein Domains: (104..24-)
    (/note="GST-C-terminal")
  • Interpro: IPR002946  IPR010987  IPR036282  IPR040079  IPR036249  
  • Prosite: PS50405
  • PDB: 2AHE 2D2Z 3OQS
  • PDBsum: 2AHE 2D2Z 3OQS
  • STRING: ENSP00000363500
• Other Databases: GeneCards:  CLIC4  Malacards:  CLIC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IBA	biological process
GO:0005254	chloride channel activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0034707	chloride channel complex	IEA	cellular component
GO:0006821	chloride transport	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0005254	chloride channel activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005254	chloride channel activity	TAS	molecular function
GO:0005622	intracellular	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048754	branching morphogenesis of an epithelial tube	IEA	biological process
GO:0009566	fertilization	IEA	biological process
GO:0007035	vacuolar acidification	IEA	biological process
GO:0001886	endothelial cell morphogenesis	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0061299	retina vasculature morphogenesis in camera-type eye	IEA	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0030216	keratinocyte differentiation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0016363	nuclear matrix	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:0030336	negative regulation of cell migration	IDA	biological process
GO:0005911	cell-cell junction	IDA	cellular component
GO:0005902	microvillus	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0045177	apical part of cell	IDA	cellular component
GO:0016363	nuclear matrix	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	colocalizes with
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0051493	regulation of cytoskeleton organization	NAS	biological process
GO:0030154	cell differentiation	TAS	biological process
GO:0035088	establishment or maintenance of apical/basal cell polarity	NAS	biological process
GO:0071277	cellular response to calcium ion	IMP	biological process
GO:0015629	actin cytoskeleton	TAS	cellular component
GO:0006821	chloride transport	NAS	biological process
GO:0030216	keratinocyte differentiation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881