• Gene id: 259296

Gene Summary

• Gene Symbol: TAS2R50   Gene   UCSC   Ensembl
• Aliases: T2R50, T2R51, TAS2R51
• Gene name: taste 2 receptor member 50
• Alternate names: taste receptor type 2 member 50, taste receptor type 2 member 51, taste receptor, type 2, member 50,
• Gene location: 12p13.2 (10986911: 10985912)     Exons: 1     NC_000012.12
• Gene summary(Entrez): TAS2R50 belongs to the large TAS2R receptor family. TAS2Rs are expressed on the surface of taste receptor cells and mediate the perception of bitterness through a G protein-coupled second messenger pathway (Conte et al., 2002 [PubMed 12584440]). See also
• OMIM: 609627

Protein Summary

• Protein general information: P59544  
  • Name: Taste receptor type 2 member 50 (T2R50) (Taste receptor type 2 member 51) (T2R51)
  • Length: 299  
  • Mass: 34558
  • Tissue specificity: Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells.
• Sequence:

  MITFLYIFFSILIMVLFVLGNFANGFIALVNFIDWVKRKKISSADQILTALAVSRIGLLWALLLNWYLTVLNPAF
  YSVELRITSYNAWVVTNHFSMWLAANLSIFYLLKIANFSNLLFLHLKRRVRSVILVILLGTLIFLVCHLLVANMD
  ESMWAEEYEGNMTGKMKLRNTVHLSYLTVTTLWSFIPFTLSLISFLMLICSLCKHLKKMQLHGEGSQDLSTKVHI
  KALQTLISFLLLCAIFFLFLIVSVWSPRRLRNDPVVMVSKAVGNIYLAFDSFILIWRTKKLKHTFLLILCQIRC

• Structural information:
  • Interpro: IPR007960  
  • STRING: ENSP00000424040
• Other Databases: GeneCards:  TAS2R50  Malacards:  TAS2R50

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033038	bitter taste receptor activity	IBA	molecular function
GO:0016021	integral component of membrane	IBA	cellular component
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IBA	biological process
GO:0050909	sensory perception of taste	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0050909	sensory perception of taste	IEA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0033038	bitter taste receptor activity	IDA	molecular function
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	biological process
GO:0016021	integral component of membrane	IC	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04742	Taste transduction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)