• Gene id: 259294

Gene Summary

• Gene Symbol: TAS2R19   Gene   UCSC   Ensembl
• Aliases: MSTP058, T2R19, T2R23, T2R48, TAS2R23, TAS2R48
• Gene name: taste 2 receptor member 19
• Alternate names: taste receptor type 2 member 19, taste receptor, type 2, member 19, taste receptor, type 2, member 23, taste receptor, type 2, member 48,
• Gene location: 12p13.2 (59940304: 59936662)     Exons: 1     NC_000020.11
• OMIM: 613961

Protein Summary

• Protein general information: P59542  
  • Name: Taste receptor type 2 member 19 (Taste receptor type 2 member 23) (Taste receptor type 2 member 48) (T2R48)
  • Length: 299  
  • Mass: 33908
  • Tissue specificity: Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells.
• Sequence:

  MMCFLLIISSILVVFAFVLGNVANGFIALVNVIDWVNTRKISSAEQILTALVVSRIGLLWVMLFLWYATVFNSAL
  YGLEVRIVASNAWAVTNHFSMWLAASLSIFCLLKIANFSNLISLHLKKRIKSVVLVILLGPLVFLICNLAVITMD
  ERVWTKEYEGNVTWKIKLRNAIHLSSLTVTTLANLIPFTLSLICFLLLICSLCKHLKKMRLHSKGSQDPSTKVHI
  KALQTVTSFLMLFAIYFLCIITSTWNLRTQQSKLVLLLCQTVAIMYPSFHSFILIMGSRKLKQTFLSVLWQMTR

• Structural information:
  • Interpro: IPR007960  
  • STRING: ENSP00000375091
• Other Databases: GeneCards:  TAS2R19  Malacards:  TAS2R19

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IBA	cellular component
GO:0050909	sensory perception of taste	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050909	sensory perception of taste	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IEA	biological process
GO:0033038	bitter taste receptor activity	IDA	NOT|molecular function
GO:0016021	integral component of membrane	IDA	cellular component
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	NOT|biological process

KEGG pathways

Pathway id	Pathway name
hsa04742	Taste transduction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)