• Gene id: 259285

Gene Summary

• Gene Symbol: TAS2R39   Gene   UCSC   Ensembl
• Aliases: T2R39, T2R57
• Gene name: taste 2 receptor member 39
• Alternate names: taste receptor type 2 member 39, taste receptor type 2 member 57, taste receptor, type 2, member 39,
• Gene location: 7q34 (143183418: 143184434)     Exons: 1     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene is a bitter taste receptor that detects green tea catechins, soy isoflavones, and theaflavins. The encoded protein is gustducin-linked and may activate alpha gustducin. This gene is intronless. [provided by RefSeq, Dec 201
• OMIM: 603617

Protein Summary

• Protein general information: P59534  
  • Name: Taste receptor type 2 member 39 (T2R39) (Taste receptor type 2 member 57) (T2R57)
  • Length: 338  
  • Mass: 38626
  • Tissue specificity: Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells.
• Sequence:

  MLGRCFPPDTKEKQQLRMTKLCDPAESELSPFLITLILAVLLAEYLIGIIANGFIMAIHAAEWVQNKAVSTSGRI
  LVFLSVSRIALQSLMMLEITISSTSLSFYSEDAVYYAFKISFIFLNFCSLWFAAWLSFFYFVKIANFSYPLFLKL
  RWRITGLIPWLLWLSVFISFSHSMFCINICTVYCNNSFPIHSSNSTKKTYLSEINVVGLAFFFNLGIVTPLIMFI
  LTATLLILSLKRHTLHMGSNATGSNDPSMEAHMGAIKAISYFLILYIFNAVALFIYLSNMFDINSLWNNLCQIIM
  AAYPASHSILLIQDNPGLRRAWKRLQLRLHLYPKEWTL

• Structural information:
  • Interpro: IPR007960  
  • PDB: 2GFZ
  • PDBsum: 2GFZ
  • STRING: ENSP00000405095
• Other Databases: GeneCards:  TAS2R39  Malacards:  TAS2R39

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033038	bitter taste receptor activity	IBA	molecular function
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0050909	sensory perception of taste	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050909	sensory perception of taste	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0033038	bitter taste receptor activity	IDA	molecular function
GO:0016021	integral component of membrane	IC	cellular component
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04742	Taste transduction

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray