• Gene id: 25928

Gene Summary

• Gene Symbol: SOSTDC1   Gene   UCSC   Ensembl
• Aliases: CDA019, DAND7, ECTODIN, USAG1
• Gene name: sclerostin domain containing 1
• Alternate names: sclerostin domain-containing protein 1, cystine-knot containing secreted protein, ectodermal BMP inhibitor, uterine sensitization-associated protein-1, wise,
• Gene location: 7p21.2 (16465737: 16461480)     Exons: 2     NC_000007.14
• Gene summary(Entrez): This gene is a member of the sclerostin family and encodes an N-glycosylated, secreted protein with a C-terminal cystine knot-like domain. This protein functions as a bone morphogenetic protein (BMP) antagonist. Specifically, it directly associates with B
• OMIM: 609675

Protein Summary

• Protein general information: Q6X4U4  
  • Name: Sclerostin domain containing protein 1 (Ectodermal BMP inhibitor) (Ectodin) (Uterine sensitization associated gene 1 protein) (USAG 1)
  • Length: 206  
  • Mass: 23307
  • Tissue specificity: Highly expressed in kidney and weakly in lung. {ECO
• Sequence:

  MLPPAIHFYLLPLACILMKSCLAFKNDATEILYSHVVKPVPAHPSSNSTLNQARNGGRHFSNTGLDRNTRVQVGC
  RELRSTKYISDGQCTSISPLKELVCAGECLPLPVLPNWIGGGYGTKYWSRRSSQEWRCVNDKTRTQRIQLQCQDG
  STRTYKITVVTACKCKRYTRQHNESSHNFESMSPAKPVQHHRERKRASKSSKHSMS

• Structural information:
  • Protein Domains: (75..17-)
    (/note="CTCK-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00039"-)
  • Interpro: IPR006207  IPR029034  IPR008835  
  • Prosite: PS01225
  • STRING: ENSP00000304930
• Other Databases: GeneCards:  SOSTDC1  Malacards:  SOSTDC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030178	negative regulation of Wnt signaling pathway	IBA	biological process
GO:0030514	negative regulation of BMP signaling pathway	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0036122	BMP binding	IBA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0031069	hair follicle morphogenesis	IEA	biological process
GO:0010454	negative regulation of cell fate commitment	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0060648	mammary gland bud morphogenesis	IEA	biological process
GO:0042475	odontogenesis of dentin-containing tooth	IEA	biological process
GO:0030514	negative regulation of BMP signaling pathway	IEA	biological process
GO:0007389	pattern specification process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030509	BMP signaling pathway	IEA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IDA	biological process
GO:0030514	negative regulation of BMP signaling pathway	IDA	biological process
GO:0098821	BMP receptor activity	IDA	molecular function
GO:0036122	BMP binding	IDA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:2000016	negative regulation of determination of dorsal identity	IDA	biological process
GO:0045662	negative regulation of myoblast differentiation	IDA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R