• Gene id: 25927

Gene Summary

• Gene Symbol: CNRIP1   Gene   UCSC   Ensembl
• Aliases: C2orf32, CRIP-1, CRIP1
• Gene name: cannabinoid receptor interacting protein 1
• Alternate names: CB1 cannabinoid receptor-interacting protein 1, cannabinoid receptor CB1-interacting protein 1,
• Gene location: 2p14 (68319948: 68284170)     Exons: 5     NC_000002.12
• Gene summary(Entrez): This gene encodes a protein that interacts with the C-terminal tail of cannabinoid receptor 1. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2013]

Protein Summary

• Protein general information: Q96F85  
  • Name: CB1 cannabinoid receptor interacting protein 1 (CRIP 1)
  • Length: 164  
  • Mass: 18648
• Sequence:

  MGDLPGLVRLSIALRIQPNDGPVFYKVDGQRFGQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVPLELKS
  KEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPN
  ETRSLMWVNKESFL

• Structural information:
  • Interpro: IPR029204  
  • STRING: ENSP00000263655
• Other Databases: GeneCards:  CNRIP1  Malacards:  CNRIP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000272	negative regulation of signaling receptor activity	IBA	biological process
GO:0031718	type 1 cannabinoid receptor binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0031718	type 1 cannabinoid receptor binding	IEA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0008022	protein C-terminus binding	IDA	molecular function
GO:0031718	type 1 cannabinoid receptor binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R