• Gene id: 259240

Gene Summary

• Gene Symbol: WFDC9   Gene   UCSC   Ensembl
• Aliases: WAP9, dJ688G8.2
• Gene name: WAP four-disulfide core domain 9
• Alternate names: protein WFDC9,
• Gene location: 20q13.12 (45631283: 45607938)     Exons: 5     NC_000020.11
• Gene summary(Entrez): The WAP-type four-disulfide core (WFDC) domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many members of the WFDC domain family. This gene encodes a

Protein Summary

• Protein general information: Q8NEX5  
  • Name: Protein WFDC9
  • Length: 89  
  • Mass: 10506
• Sequence:

  MKPWILLLVMFISGVVMLLPVLGSFWNKDPFLDMIRETEQCWVQPPYKYCEKRCTKIMTCVRPNHTCCWTYCGNI
  CLDNEEPLKSMLNP

• Structural information:
  • Interpro: IPR029725  
  • STRING: ENSP00000320532
• Other Databases: GeneCards:  WFDC9  Malacards:  WFDC9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004867	serine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0045087	innate immune response	IBA	biological process
GO:0019731	antibacterial humoral response	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)