• Gene id: 25921

Gene Summary

• Gene Symbol: ZDHHC5   Gene   UCSC   Ensembl
• Aliases: DHHC5, ZNF375
• Gene name: zinc finger DHHC-type palmitoyltransferase 5
• Alternate names: palmitoyltransferase ZDHHC5, DHHC-5, membrane-associated DHHC5 zinc finger protein, probable palmitoyltransferase ZDHHC5, zinc finger DHHC domain-containing protein 5, zinc finger DHHC-type containing 5, zinc finger protein 375, zinc finger, DHHC domain containi,
• Gene location: 11q12.1 (169812903: 169793002)     Exons: 11     NC_000003.12
• OMIM: 614586

Protein Summary

• Protein general information: Q9C0B5  
  • Name: Palmitoyltransferase ZDHHC5 (EC 2.3.1.225) (Zinc finger DHHC domain containing protein 5) (DHHC 5) (Zinc finger protein 375)
  • Length: 715  
  • Mass: 77545
• Sequence:

  MPAESGKRFKPSKYVPVSAAAIFLVGATTLFFAFTCPGLSLYVSPAVPIYNAIMFLFVLANFSMATFMDPGIFPR
  AEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFF
  LFLLSLTAHIMGVFGFGLLYVLYHIEELSGVRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKF
  RGGVNPFTNGCCNNVSRVLCSSPAPRYLGRPKKEKTIVIRPPFLRPEVSDGQITVKIMDNGIQGELRRTKSKGSL
  EITESQSADAEPPPPPKPDLSRYTGLRTHLGLATNEDSSLLAKDSPPTPTMYKYRPGYSSSSTSAAMPHSSSAKL
  SRGDSLKEPTSIAESSRHPSYRSEPSLEPESFRSPTFGKSFHFDPLSSGSRSSSLKSAQGTGFELGQLQSIRSEG
  TTSTSYKSLANQTRNGSLSYDSLLTPSDSPDFESVQAGPEPDPPLGYTSPFLSARLAQQREAERHPRLVPTGPTH
  REPSPVRYDNLSRHIVASLQEREKLLRQSPPLPGREEEPGLGDSGIQSTPGSGHAPRTSSSSDDSKRSPLGKTPL
  GRPAVPRFGKPDGLRGRGVGSPEPGPTAPYLGRSMSYSSQKAQPGVSETEEVALQPLLTPKDEVQLKTTYSKSNG
  QPKSLGSASPGPGQPPLSSPTRGGVKKVSGVGGTTYEISV

• Structural information:
  • Protein Domains: (104..15-)
    (/note="DHHC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00067"-)
  • Interpro: IPR001594  
  • Prosite: PS50216
  • STRING: ENSP00000287169
• Other Databases: GeneCards:  ZDHHC5  Malacards:  ZDHHC5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0016409	palmitoyltransferase activity	IBA	molecular function
GO:0018345	protein palmitoylation	IBA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0045335	phagocytic vesicle	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:1903078	positive regulation of protein localization to plasma membrane	IMP	biological process
GO:0062208	positive regulation of pattern recognition receptor signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IEA	molecular function
GO:0018345	protein palmitoylation	IDA	biological process
GO:0016409	palmitoyltransferase activity	IDA	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0018345	protein palmitoylation	IEA	biological process
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016409	palmitoyltransferase activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0018345	protein palmitoylation	IDA	biological process
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)