• Gene id: 259197

Gene Summary

• Gene Symbol: NCR3   Gene   UCSC   Ensembl
• Aliases: 1C7, CD337, LY117, MALS, NKp30
• Gene name: natural cytotoxicity triggering receptor 3
• Alternate names: natural cytotoxicity triggering receptor 3, NK-p30, activating NK-A1 receptor, activating natural killer receptor p30, lymphocyte antigen 117, natural killer cell p30-related protein,
• Gene location: 6p21.33 (2212719: 2184456)     Exons: 17     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a natural cytotoxicity receptor (NCR) that may aid NK cells in the lysis of tumor cells. The encoded protein interacts with CD3-zeta (CD247), a T-cell receptor. A single nucleotide polymorphism in the 5' untranslated re
• OMIM: 611550

Protein Summary

• Protein general information: O14931  
  • Name: Natural cytotoxicity triggering receptor 3 (Activating natural killer receptor p30) (Natural killer cell p30 related protein) (NK p30) (NKp30) (CD antigen CD337)
  • Length: 201  
  • Mass: 21593
  • Tissue specificity: Selectively expressed by all resting and activated NK cells and weakly expressed in spleen. {ECO
• Sequence:

  MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRG
  RLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVS
  FLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG

• Structural information:
  • Protein Domains: (19..12-)
    (/note="Ig-like"-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106  
  • Prosite: PS50835
  • PDB: 3NOI 3PV6
  • PDBsum: 3NOI 3PV6
  • DIP: 59939
  • STRING: ENSP00000342156
• Other Databases: GeneCards:  NCR3  Malacards:  NCR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030101	natural killer cell activation	IBA	biological process
GO:0002429	immune response-activating cell surface receptor signaling pathway	IBA	biological process
GO:0045954	positive regulation of natural killer cell mediated cytotoxicity	IBA	biological process
GO:0030101	natural killer cell activation	IDA	biological process
GO:0002429	immune response-activating cell surface receptor signaling pathway	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0002429	immune response-activating cell surface receptor signaling pathway	IEA	biological process
GO:0045954	positive regulation of natural killer cell mediated cytotoxicity	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008037	cell recognition	TAS	biological process
GO:0045954	positive regulation of natural killer cell mediated cytotoxicity	IMP	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0006955	immune response	NAS	biological process
GO:0006954	inflammatory response	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04650	Natural killer cell mediated cytotoxicity

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)