• Gene id: 25911

Gene Summary

• Gene Symbol: DPCD   Gene   UCSC   Ensembl
• Gene name: deleted in primary ciliary dyskinesia homolog (mouse)
• Alternate names: protein DPCD, RP11-529I10.4, deleted in a mouse model of primary ciliary dyskinesia,
• Gene location: 10q24.32 (80106609: 80469087)     Exons: 21     NC_000006.12
• Gene summary(Entrez): This gene in mouse encodes a protein that may be involved in the generation and maintenance of ciliated cells. In mouse, expression of this gene increases during ciliated cell differentiation, and disruption of this gene has been linked to primary ciliary
• OMIM: 616467

Protein Summary

• Protein general information: Q9BVM2  
  • Name: Protein DPCD
  • Length: 203  
  • Mass: 23240
  • Tissue specificity: Highly expressed in the testis. Weakly expressed in pancreas, skeletal muscle and heart. Expression increases during ciliated cell differentiation. {ECO
• Sequence:

  MAVTGWLESLRTAQKTALLQDGRRKVHYLFPDGKEMAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLG
  AGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVDQKERCIIVRTTNKKYYKKFSIPDLDRHQL
  PLDDALLSFAHANCTLIISYQKPKEVVVAESELQKELKKVKTAHSNDGDCKTQ

• Structural information:
  • Interpro: IPR026224  
  • STRING: ENSP00000359170
• Other Databases: GeneCards:  DPCD  Malacards:  DPCD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0021678	third ventricle development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0003351	epithelial cilium movement involved in extracellular fluid movement	IEA	biological process
GO:0060972	left/right pattern formation	IEA	biological process
GO:0030317	flagellated sperm motility	IEA	biological process
GO:0021670	lateral ventricle development	IEA	biological process
GO:0021591	ventricular system development	IEA	biological process
GO:0007368	determination of left/right symmetry	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005634	nucleus	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881