• Gene id: 25907

Gene Summary

• Gene Symbol: TMEM158   Gene   UCSC   Ensembl
• Aliases: BBP, RIS1, p40BBP
• Gene name: transmembrane protein 158
• Alternate names: transmembrane protein 158, 40 kDa BINP-binding protein, BINP receptor, Ras induced senescence 1, brain injury-derived neurotrophic peptide (BINP) binding protein, brain specific binding protein,
• Gene location: 3p21.31 (45226286: 45224465)     Exons: 9     NC_000003.12
• Gene summary(Entrez): Constitutive activation of the Ras pathway triggers an irreversible proliferation arrest reminiscent of replicative senescence. Transcription of this gene is upregulated in response to activation of the Ras pathway, but not under other conditions that ind

Protein Summary

• Protein general information: Q8WZ71  
  • Name: Transmembrane protein 158 (40 kDa BINP binding protein) (p40BBP) (Ras induced senescence protein 1)
  • Length: 300  
  • Mass: 30404
• Sequence:

  MLPLLAALLAAACPLPPVRGGAADAPGLLGVPSNASVNASSADEPIAPRLLASAAPGPPERPGPEEAAAAAAPCN
  ISVQRQMLSSLLVRWGRPRGFQCDLLLFSTNAHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVR
  GRRTGRLRPAAAPSAAAATAGAPTALPAYPAAEPPGPLWLQGEPLHFCCLDFSLEELQGEPGWRLNRKPIESTLV
  ACFMTLVIVVWSVAALIWPVPIIAGFLPNGMEQRRTTASTTAATPAAVPAGTTAAAAAAAAAAAAAAVTSGVATK

• Structural information:
  • Interpro: IPR038962  
  • STRING: ENSP00000422431
• Other Databases: GeneCards:  TMEM158  Malacards:  TMEM158

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042277	peptide binding	IBA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0042277	peptide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)