• Gene id: 25906

Gene Summary

• Gene Symbol: ANAPC15   Gene   UCSC   Ensembl
• Aliases: APC15, C11orf51, HSPC020
• Gene name: anaphase promoting complex subunit 15
• Alternate names: anaphase-promoting complex subunit 15,
• Gene location: 11q13.4 (72112775: 72106371)     Exons: 11     NC_000011.10
• OMIM: 614717

Protein Summary

• Protein general information: P60006  
  • Name: Anaphase promoting complex subunit 15 (APC15)
  • Length: 121  
  • Mass: 14281
• Sequence:

  MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDED
  SEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI

• Structural information:
  • Interpro: IPR026182  
  • PDB: 4UI9 5A31 5G04 5G05 5L9T 5L9U 5LCW 6Q6G 6Q6H
  • PDBsum: 4UI9 5A31 5G04 5G05 5L9T 5L9U 5LCW 6Q6G 6Q6H
  • DIP: 61021
  • STRING: ENSP00000439403
• Other Databases: GeneCards:  ANAPC15  Malacards:  ANAPC15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005680	anaphase-promoting complex	IBA	cellular component
GO:0090266	regulation of mitotic cell cycle spindle assembly checkpoint	IBA	biological process
GO:0005680	anaphase-promoting complex	IDA	cellular component
GO:0090266	regulation of mitotic cell cycle spindle assembly checkpoint	IMP	biological process
GO:0005680	anaphase-promoting complex	IEA	cellular component
GO:0090266	regulation of mitotic cell cycle spindle assembly checkpoint	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:1901990	regulation of mitotic cell cycle phase transition	TAS	biological process
GO:0005622	intracellular	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray