• Gene id: 25898

Gene Summary

• Gene Symbol: RCHY1   Gene   UCSC   Ensembl
• Aliases: ARNIP, CHIMP, PIRH2, PRO1996, RNF199, ZCHY, ZNF363
• Gene name: ring finger and CHY zinc finger domain containing 1
• Alternate names: RING finger and CHY zinc finger domain-containing protein 1, CH-rich interacting match with PLAG1, E3 ubiquitin-protein ligase Pirh2, RING finger protein 199, RING-type E3 ubiquitin transferase RCHY1, androgen-receptor N-terminal-interacting protein, p53-induce,
• Gene location: 4q21.1 (75515056: 75479036)     Exons: 10     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene has ubiquitin ligase activity. It mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including tumor protein 53, histone deacetylase 1, and cyclin-dependent kinase inhibitor 1B, thus regul
• OMIM: 0

Protein Summary

• Protein general information: Q96PM5  
  • Name: RING finger and CHY zinc finger domain containing protein 1 (EC 2.3.2.27) (Androgen receptor N terminal interacting protein) (CH rich interacting match with PLAG1) (E3 ubiquitin protein ligase Pirh2) (RING finger protein 199) (RING type E3 ubiquitin trans
  • Length: 261  
  • Mass: 30110
• Sequence:

  MAATAREDGASGQERGQRGCEHYDRGCLLKAPCCDKLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQHAQQTC
  EECSTLFGEYYCDICHLFDKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGRHKCIENVSRQNCPICLE
  DIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHSALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDC
  NGRSTVQFHILGMKCKICESYNTAQAGGRRISLDQQ

• Structural information:
  • Interpro: IPR039512  IPR008913  IPR037274  IPR017921  IPR037275   IPR001841  IPR013083  
  • Prosite: PS51266 PS51270 PS50089
  • PDB: 2JRJ 2K2C 2K2D
  • PDBsum: 2JRJ 2K2C 2K2D
  • DIP: 43981
  • STRING: ENSP00000321239
• Other Databases: GeneCards:  RCHY1  Malacards:  RCHY1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0016567	protein ubiquitination	IBA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0008270	zinc ion binding	IDA	molecular function
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0000151	ubiquitin ligase complex	IDA	cellular component
GO:0031398	positive regulation of protein ubiquitination	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0002039	p53 binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0070987	error-free translesion synthesis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016607	nuclear speck	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis
hsa05162	Measles
hsa04115	p53 signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray