• Gene id: 25897

Gene Summary

• Gene Symbol: RNF19A   Gene   UCSC   Ensembl
• Aliases: RNF19
• Gene name: ring finger protein 19A, RBR E3 ubiquitin protein ligase
• Alternate names: E3 ubiquitin-protein ligase RNF19A, double ring-finger protein, protein p38 interacting with transcription factor Sp1, ring finger protein 19, ring finger protein 19A, E3 ubiquitin protein ligase, ring-IBR-ring domain containing protein Dorfin,
• Gene location: 8q22.2 (100336203: 100257058)     Exons: 15     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of the ring between ring fingers (RBR) protein family, and the encoded protein contains two RING-finger motifs and an in between RING fingers motif. This protein is an E3 ubiquitin ligase that is localized to Lewy bodies, and ub
• OMIM: 607119

Protein Summary

• Protein general information: Q9NV58  
  • Name: E3 ubiquitin protein ligase RNF19A (EC 2.3.2.31) (Double ring finger protein) (Dorfin) (RING finger protein 19A) (p38)
  • Length: 838  
  • Mass: 90696
  • Tissue specificity: Widely expressed, with highest levels in heart. Ubiquitously expressed in the central nervous system. {ECO
• Sequence:

  MQEQEIGFISKYNEGLCVNTDPVSILTSILDMSLHRQMGSDRDLQSSASSVSLPSVKKAPKKRRISIGSLFRRKK
  DNKRKSRELNGGVDGIASIESIHSEMCTDKNSIFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTC
  HHRSCVDCLRQYLRIEISESRVNISCPECTERFNPHDIRLILSDDVLMEKYEEFMLRRWLVADPDCRWCPAPDCG
  YAVIAFGCASCPKLTCGREGCGTEFCYHCKQIWHPNQTCDAARQERAQSLRLRTIRSSSISYSQESGAAADDIKP
  CPRCAAYIIKMNDGSCNHMTCAVCGCEFCWLCMKEISDLHYLSPSGCTFWGKKPWSRKKKILWQLGTLVGAPVGI
  ALIAGIAIPAMIIGIPVYVGRKIHNRYEGKDVSKHKRNLAIAGGVTLSVIVSPVVAAVTVGIGVPIMLAYVYGVV
  PISLCRSGGCGVSAGNGKGVRIEFDDENDINVGGTNTAVDTTSVAEARHNPSIGEGSVGGLTGSLSASGSHMDRI
  GAIRDNLSETASTMALAGASITGSLSGSAMVNCFNRLEVQADVQKERYSLSGESGTVSLGTVSDNASTKAMAGSI
  LNSYIPLDKEGNSMEVQVDIESKPSKFRHNSGSSSVDDGSATRSHAGGSSSGLPEGKSSATKWSKEATAGKKSKS
  GKLRKKGNMKINETREDMDAQLLEQQSTNSSEFEAPSLSDSMPSVADSHSSHFSEFSCSDLESMKTSCSHGSSDY
  HTRFATVNILPEVENDRLENSPHQCSISVVTQTASCSEVSQLNHIAEEHGNNGIKPNVDLYFGDALKETNNNHSH
  QTMELKVAIQTEI

• Structural information:
  • Interpro: IPR031127  IPR002867  IPR001841  IPR013083  
  • Prosite: PS51873 PS50089
  • STRING: ENSP00000428968
• Other Databases: GeneCards:  RNF19A  Malacards:  RNF19A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0000151	ubiquitin ligase complex	IBA	cellular component
GO:0031624	ubiquitin conjugating enzyme binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0004842	ubiquitin-protein transferase activity	IEA	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0099576	regulation of protein catabolic process at postsynapse, modulating synaptic transmission	IEA	biological process
GO:0098686	hippocampal mossy fiber to CA3 synapse	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005813	centrosome	TAS	cellular component
GO:0008134	transcription factor binding	TAS	molecular function
GO:0000226	microtubule cytoskeleton organization	TAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R