• Gene id: 25893

Gene Summary

• Gene Symbol: TRIM58   Gene   UCSC   Ensembl
• Aliases: BIA2
• Gene name: tripartite motif containing 58
• Alternate names: E3 ubiquitin-protein ligase TRIM58, RING-type E3 ubiquitin transferase TRIM58, tripartite motif-containing protein 58,
• Gene location: 1q44 (247857186: 247880137)     Exons: 6     NC_000001.11

Protein Summary

• Protein general information: Q8NG06  
  • Name: E3 ubiquitin protein ligase TRIM58 (EC 2.3.2.27) (Protein BIA2) (RING type E3 ubiquitin transferase TRIM58) (Tripartite motif containing protein 58)
  • Length: 486  
  • Mass: 54766
  • Tissue specificity: Expressed in erythroblasts. {ECO
• Sequence:

  MAWAPPGERLREDARCPVCLDFLQEPVSVDCGHSFCLRCISEFCEKSDGAQGGVYACPQCRGPFRPSGFRPNRQL
  AGLVESVRRLGLGAGPGARRCARHGEDLSRFCEEDEAALCWVCDAGPEHRTHRTAPLQEAAGSYQVKLQMALELM
  RKELEDALTQEANVGKKTVIWKEKVEMQRQRFRLEFEKHRGFLAQEEQRQLRRLEAEERATLQRLRESKSRLVQQ
  SKALKELADELQERCQRPALGLLEGVRGVLSRSKAVTRLEAENIPMELKTACCIPGRRELLRKFQVDVKLDPATA
  HPSLLLTADLRSVQDGEPWRDVPNNPERFDTWPCILGLQSFSSGRHYWEVLVGEGAEWGLGVCQDTLPRKGETTP
  SPENGVWALWLLKGNEYMVLASPSVPLLQLESPRCIGIFLDYEAGEISFYNVTDGSYIYTFNQLFSGLLRPYFFI
  CDATPLILPPTTIAGSGNWASRDHLDPASDVRDDHL

• Structural information:
  • Protein Domains: (273..46-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR003879  IPR013320  IPR006574  IPR035787   IPR003877  IPR042699  IPR000315  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50188 PS50119 PS00518 PS50089
  • CDD: cd00021 cd16606 cd15816
  • STRING: ENSP00000355437
• Other Databases: GeneCards:  TRIM58  Malacards:  TRIM58

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042803	protein homodimerization activity	IBA	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0010508	positive regulation of autophagy	IBA	biological process
GO:0016567	protein ubiquitination	IBA	biological process
GO:0019901	protein kinase binding	IBA	molecular function
GO:0032880	regulation of protein localization	IBA	biological process
GO:0046596	regulation of viral entry into host cell	IBA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0061931	positive regulation of erythrocyte enucleation	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0045505	dynein intermediate chain binding	IEA	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:1902838	regulation of nuclear migration along microtubule	IEA	biological process
GO:0051865	protein autoubiquitination	IEA	biological process
GO:0045504	dynein heavy chain binding	IEA	molecular function
GO:0000209	protein polyubiquitination	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881