• Gene id: 25875

Gene Summary

• Gene Symbol: LETMD1   Gene   UCSC   Ensembl
• Aliases: 1110019O13Rik, HCCR, HCCR-1, HCCR-2, HCCR1, HCCR2, HCRR-2, SLC55A3
• Gene name: LETM1 domain containing 1
• Alternate names: LETM1 domain-containing protein 1, cervical cancer 1 proto-oncogene protein p40, cervical cancer proto-oncogene 2 protein, epididymis secretory sperm binding protein, human cervical cancer oncogene, regulator of TP53,
• Gene location: 12q13.12 (51048219: 51068957)     Exons: 11     NC_000012.12
• Gene summary(Entrez): This gene encodes a mitochondrial outer membrane protein. It has a potential role in tumorigenesis, which may result from negative regulation of the p53 tumor suppressor gene. Alternatively spliced transcript variants have been noted for this gene. [provi

Protein Summary

• Protein general information: Q6P1Q0  
  • Name: LETM1 domain containing protein 1 (Cervical cancer 1 proto oncogene protein p40) (Cervical cancer proto oncogene 2 protein) (HCCR 1) (HCRR 2)
  • Length: 360  
  • Mass: 41790
  • Tissue specificity: Kidney, liver, skeletal muscle, heart and brain. Overexpressed in various tumors including leukemia, lymphoma, and carcinomas of the breast, kidney, ovary, stomach, colon and uterine cervix. {ECO
• Sequence:

  MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYVVTKTKAINGKYHRFL
  GRHFPRFYVLYTIFMKGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQFRQDVTKCLFLGIISIPPFA
  NYLVFLLMYLFPRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEKVIPLISDAGLRWRLTDLCTKIQRGT
  HPAIHDILALRECFSNHPLGMNQLQALHVKALSRAMLLTSYLPPPLLRHRLKTHTTVIHQLDKALAKLGIGQLTA
  QEVKSACYLRGLNSTHIGEDRCRTWLGEWLQISCSLKEAELSLLLHNVVLLSTNYLGTRR

• Structural information:
  • Protein Domains: (186..36-)
    (/note="Letm1-RBD)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01094"-)
  • Interpro: IPR011685  IPR033122  
  • Prosite: PS51758
  • STRING: ENSP00000389903
• Other Databases: GeneCards:  LETMD1  Malacards:  LETMD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043022	ribosome binding	IEA	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component

Diseases

Associated diseases	References
Breast cancer	PMID:19208263
Uterine cancer	PMID:12879013
ovarian carcinoma	PMID:12879013
renal carcinoma	PMID:12879013
stomach carcinoma	PMID:12879013
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)