• Gene id: 25870

Gene Summary

• Gene Symbol: SUMF2   Gene   UCSC   Ensembl
• Aliases: pFGE
• Gene name: sulfatase modifying factor 2
• Alternate names: inactive C-alpha-formylglycine-generating enzyme 2, C-alpha-formyglycine-generating enzyme 2, C-alpha-formylglycine-generating enzyme 2, epididymis secretory sperm binding protein, paralog of formylglycine-generating enzyme, paralog of the formylglycine-genera,
• Gene location: 7p11.2 (56064006: 56080671)     Exons: 11     NC_000007.14
• Gene summary(Entrez): The catalytic sites of sulfatases are only active if they contain a unique amino acid, C-alpha-formylglycine (FGly). The FGly residue is posttranslationally generated from a cysteine by enzymes with FGly-generating activity. The gene described in this rec
• OMIM: 614604

Protein Summary

• Protein general information: Q8NBJ7  
  • Name: Inactive C alpha formylglycine generating enzyme 2 (Paralog of formylglycine generating enzyme) (pFGE) (Sulfatase modifying factor 2)
  • Length: 301  
  • Mass: 33843
  • Tissue specificity: Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highest levels in kidney, liver and placenta. {ECO
• Sequence:

  MARHGLPLLPLLSLLVGAWLKLGNGQATSMVQLQGGRFLMGTNSPDSRDGDGPVREATVKPFAIDIFPVTNKDFR
  DFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAFWRQPAGPGSGIRERLEHPVLHVSWN
  DARAYCAWRGKRLPTEEEWEFAARGGLKGQVYPWGNWFQPNRTNLWQGKFPKGDKAEDGFHGVSPVNAFPAQNNY
  GLYDLLGNVWEWTASPYQAAEQDMRVLRGASWIDTADGSANHRARVTTRMGNTPDSASDNLGFRCAADAGRPPGE
  L

• Structural information:
  • Interpro: IPR016187  IPR005532  IPR042095  
  • PDB: 1Y4J
  • PDBsum: 1Y4J
  • STRING: ENSP00000341938
• Other Databases: GeneCards:  SUMF2  Malacards:  SUMF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0006687	glycosphingolipid metabolic process	TAS	biological process
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881