• Gene id: 2587

Gene Summary

• Gene Symbol: GALR1   Gene   UCSC   Ensembl
• Aliases: GALNR, GALNR1
• Gene name: galanin receptor 1
• Alternate names: galanin receptor type 1, GAL1-R, GALR-1,
• Gene location: 18q23 (77249847: 77277899)     Exons: 4     NC_000018.10
• Gene summary(Entrez): The neuropeptide galanin elicits a range of biological effects by interaction with specific G-protein-coupled receptors. Galanin receptors are seven-transmembrane proteins shown to activate a variety of intracellular second-messenger pathways. GALR1 inh
• OMIM: 612327

Protein Summary

• Protein general information: P47211  
  • Name: Galanin receptor type 1 (GAL1 R) (GALR 1)
  • Length: 349  
  • Mass: 38953
• Sequence:

  MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVTLVVFGLIFALGVLGNSLVITVLARSKPGKPRSTTNLFIL
  NLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSMLVSIFTLAAMSVDRYVAIVHSRRSSSLRVSR
  NALLGVGCIWALSIAMASPVAYHQGLFHPRASNQTFCWEQWPDPRHKKAYVVCTFVFGYLLPLLLICFCYAKVLN
  HLHKKLKNMSKKSEASKKKTAQTVLVVVVVFGISWLPHHIIHLWAEFGVFPLTPASFLFRITAHCLAYSNSSVNP
  IIYAFLSENFRKAYKQVFKCHIRKDSHLSDTKESKSRIDTPPSTNCTHV

• Structural information:
  • Interpro: IPR003906  IPR000405  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000299727
• Other Databases: GeneCards:  GALR1  Malacards:  GALR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0008528	G protein-coupled peptide receptor activity	IBA	molecular function
GO:0007218	neuropeptide signaling pathway	IBA	biological process
GO:0017046	peptide hormone binding	IDA	molecular function
GO:0004966	galanin receptor activity	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004966	galanin receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007194	negative regulation of adenylate cyclase activity	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004966	galanin receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0007194	negative regulation of adenylate cyclase activity	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0007218	neuropeptide signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0042923	neuropeptide binding	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004966	galanin receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0051464	positive regulation of cortisol secretion	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia, Oligozoospermia	MIK: 19478329

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
19478329	Azoospermia, Oligozoospermia	rs2032278	Caucasi an	55 cases	Male infertility	GWAS