• Gene id: 25865

Gene Summary

• Gene Symbol: PRKD2   Gene   UCSC   Ensembl
• Aliases: HSPC187, PKD2, nPKC-D2
• Gene name: protein kinase D2
• Alternate names: serine/threonine-protein kinase D2,
• Gene location: 19q13.32 (46717126: 46674315)     Exons: 19     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the protein kinase D (PKD) family of serine/threonine protein kinases. This kinase can be activated by phorbol esters as well as by gastrin via the cholecystokinin B receptor (CCKBR) in gastric cancer cells. It
• OMIM: 176879

Protein Summary

• Protein general information: Q9BZL6  
  • Name: Serine/threonine protein kinase D2 (EC 2.7.11.13) (nPKC D2)
  • Length: 878  
  • Mass: 96722
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLLPAASELAHVKQLACS
  IVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDLVEVVLSASATFEDFQIRPHALTVHSYRAPA
  FCDHCGEMLFGLVRQGLKCDGCGLNYHKRCAFSIPNNCSGARKRRLSSTSLASGHSVRLGTSESLPCTAEELSRS
  TTELLPRRPPSSSSSSSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCKF
  NCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSALMDESEDSGVIPGSHSENALHASEEEEGEGGKAQSS
  LGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWRLDCKCITLFQNNTTNRYYKEIPLSEILTVE
  SAQNFSLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPSGQGAEAARGWETAIRQALMPVILQDAPSAPGHAPH
  RQASLSISVSNSQIQENVDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVA
  ILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERLTKFLITQILVALRHLHFKNIVHCDL
  KPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLLNQGYNRSLDMWSVGVIMYVSLSGTFP
  FNEDEDINDQIQNAAFMYPASPWSHISAGAIDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGE
  RYITHESDDARWEQFAAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL

• Structural information:
  • Protein Domains: (397..50-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (551..80-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR020454  IPR011009  IPR002219  IPR011993  IPR001849   IPR000719  IPR017441  IPR015727  IPR008271  
  • Prosite: PS50003 PS00107 PS50011 PS00108 PS00479 PS50081
  • CDD: cd00029
  • PDB: 2COA 3BGM 4NNX 4NNY
  • PDBsum: 2COA 3BGM 4NNX 4NNY
  • STRING: ENSP00000393978
• Other Databases: GeneCards:  PRKD2  Malacards:  PRKD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006468	protein phosphorylation	IDA	biological process
GO:0089700	protein kinase D signaling	IBA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0050862	positive regulation of T cell receptor signaling pathway	ISS	biological process
GO:0045743	positive regulation of fibroblast growth factor receptor signaling pathway	IMP	biological process
GO:0032757	positive regulation of interleukin-8 production	IMP	biological process
GO:0032743	positive regulation of interleukin-2 production	ISS	biological process
GO:0030949	positive regulation of vascular endothelial growth factor receptor signaling pathway	IMP	biological process
GO:0010595	positive regulation of endothelial cell migration	IMP	biological process
GO:2000573	positive regulation of DNA biosynthetic process	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IMP	biological process
GO:0045785	positive regulation of cell adhesion	IMP	biological process
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0001938	positive regulation of endothelial cell proliferation	IMP	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0001525	angiogenesis	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0004698	calcium-dependent protein kinase C activity	IEA	molecular function
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0030148	sphingolipid biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050862	positive regulation of T cell receptor signaling pathway	IEA	biological process
GO:0032743	positive regulation of interleukin-2 production	IEA	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0050852	T cell receptor signaling pathway	IDA	biological process
GO:0032793	positive regulation of CREB transcription factor activity	IGI	biological process
GO:0089700	protein kinase D signaling	IGI	biological process
GO:0043536	positive regulation of blood vessel endothelial cell migration	IMP	biological process
GO:0043536	positive regulation of blood vessel endothelial cell migration	IGI	biological process
GO:0046777	protein autophosphorylation	TAS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IMP	biological process
GO:0061154	endothelial tube morphogenesis	TAS	biological process
GO:2001028	positive regulation of endothelial cell chemotaxis	IMP	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IGI	biological process
GO:0008219	cell death	IMP	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IGI	biological process
GO:0035556	intracellular signal transduction	IMP	biological process
GO:0035556	intracellular signal transduction	IMP	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IMP	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IMP	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IGI	biological process
GO:0038033	positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway	IMP	biological process
GO:0038033	positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway	IGI	biological process
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0045766	positive regulation of angiogenesis	IGI	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:1901727	positive regulation of histone deacetylase activity	IGI	biological process
GO:1902533	positive regulation of intracellular signal transduction	IMP	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006468	protein phosphorylation	NAS	biological process
GO:0004674	protein serine/threonine kinase activity	NAS	molecular function
GO:0005080	protein kinase C binding	IPI	molecular function
GO:0018105	peptidyl-serine phosphorylation	IMP	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0018107	peptidyl-threonine phosphorylation	IMP	biological process
GO:0004674	protein serine/threonine kinase activity	IMP	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04015	Rap1 signaling pathway
hsa04925	Aldosterone synthesis and secretion
P06959	CCKR signaling map

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray