• Gene id: 25855

Gene Summary

• Gene Symbol: BRMS1   Gene   UCSC   Ensembl
• Gene name: BRMS1 transcriptional repressor and anoikis regulator
• Alternate names: breast cancer metastasis-suppressor 1, breast cancer metastasis suppressor 1,
• Gene location: 11q13.2 (66345124: 66337332)     Exons: 9     NC_000011.10
• Gene summary(Entrez): This gene reduces the metastatic potential, but not the tumorogenicity, of human breast cancer and melanoma cell lines. The protein encoded by this gene localizes primarily to the nucleus and is a component of the mSin3a family of histone deacetylase comp
• OMIM: 607928

Protein Summary

• Protein general information: Q9HCU9  
  • Name: Breast cancer metastasis suppressor 1
  • Length: 246  
  • Mass: 28461
  • Tissue specificity: Expression levels are higher in term placentas than in early placentas. Low levels of expression observed in normal pregnancies and in molar pregnancies. {ECO
• Sequence:

  MPVQPPSKDTEEMEAEGDSAAEMNGEEEESEEERSGSQTESEEESSEMDDEDYERRRSECVSEMLDLEKQFSELK
  EKLFRERLSQLRLRLEEVGAERAPEYTEPLGGLQRSLKIRIQVAGIYKGFCLDVIRNKYECELQGAKQHLESEKL
  LLYDTLQGELQERIQRLEEDRQSLDLSSEWWDDKLHARGSSRSWDSLPPSKRKKAPLVSGPYIVYMLQEIDILED
  WTAIKKARAAVSPQKRKSDGP

• Structural information:
  • Interpro: IPR013907  
  • PDB: 2XUS 4AUV
  • PDBsum: 2XUS 4AUV
  • DIP: 24250
  • STRING: ENSP00000396052
• Other Databases: GeneCards:  BRMS1  Malacards:  BRMS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070822	Sin3-type complex	IBA	cellular component
GO:0004407	histone deacetylase activity	IBA	contributes to
GO:0042826	histone deacetylase binding	IBA	molecular function
GO:0016575	histone deacetylation	IBA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0090312	positive regulation of protein deacetylation	IDA	biological process
GO:0051059	NF-kappaB binding	IDA	molecular function
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0042981	regulation of apoptotic process	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:2000210	positive regulation of anoikis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
invasive ductal carcinoma	PMID:15592684
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq