• Gene id: 25853

Gene Summary

• Gene Symbol: DCAF12   Gene   UCSC   Ensembl
• Aliases: CT102, KIAA1892, TCC52, WDR40A
• Gene name: DDB1 and CUL4 associated factor 12
• Alternate names: DDB1- and CUL4-associated factor 12, WD repeat domain 40A, WD repeat-containing protein 40A, cancer/testis antigen 102, centrosome-related protein TCC52, testis cancer centrosome-related protein,
• Gene location: 9p13.3 (34126697: 34086386)     Exons: 10     NC_000009.12
• Gene summary(Entrez): This gene encodes a WD repeat-containing protein that interacts with the COP9 signalosome, a macromolecular complex that interacts with cullin-RING E3 ligases and regulates their activity by hydrolyzing cullin-Nedd8 conjugates. [provided by RefSeq, Jul 20

Protein Summary

• Protein general information: Q5T6F0  
  • Name: DDB1 and CUL4 associated factor 12 (Centrosome related protein TCC52) (Testis cancer centrosome related protein) (WD repeat containing protein 40A)
  • Length: 453  
  • Mass: 50517
  • Tissue specificity: Highly expressed in lung cancer tissues and some cancer cell lines. Restricted expression in normal testis. {ECO
• Sequence:

  MARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLKNREVRLQNETSYSRVLHGYAAQQL
  PSLLKEREFHLGTLNKVFASQWLNHRQVVCGTKCNTLFVVDVQTSQITKIPILKDREPGGVTQQGCGIHAIELNP
  SRTLLATGGDNPNSLAIYRLPTLDPVCVGDDGHKDWIFSIAWISDTMAVSGSRDGSMGLWEVTDDVLTKSDARHN
  VSRVPVYAHITHKALKDIPKEDTNPDNCKVRALAFNNKNKELGAVSLDGYFHLWKAENTLSKLLSTKLPYCRENV
  CLAYGSEWSVYAVGSQAHVSFLDPRQPSYNVKSVCSRERGSGIRSVSFYEHIITVGTGQGSLLFYDIRAQRFLEE
  RLSACYGSKPRLAGENLKLTTGKGWLNHDETWRNYFSDIDFFPNAVYTHCYDSSGTKLFVAGGPLPSGLHGNYAG
  LWS

• Structural information:
  • Interpro: IPR015943  IPR001680  IPR019775  IPR017986  IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • PDB: 3I7P
  • PDBsum: 3I7P
  • DIP: 48760
  • STRING: ENSP00000355114
• Other Databases: GeneCards:  DCAF12  Malacards:  DCAF12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0080008	Cul4-RING E3 ubiquitin ligase complex	IBA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0080008	Cul4-RING E3 ubiquitin ligase complex	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881