• Gene id: 25849

Gene Summary

• Gene Symbol: PARM1   Gene   UCSC   Ensembl
• Aliases: Cipar1, DKFZP564O0823, PARM-1, WSC4
• Gene name: prostate androgen-regulated mucin-like protein 1
• Alternate names: prostate androgen-regulated mucin-like protein 1, WSC4, cell wall integrity and stress response component 4 homolog, castration-induced prostatic apoptosis-related protein 1, prostatic androgen-regulated mucin-like protein 1, prostatic androgen-repressed mess,
• Gene location: 4q13.3 (128739358: 128773399)     Exons: 9     NC_000007.14
• OMIM: 617688

Protein Summary

• Protein general information: Q6UWI2  
  • Name: Prostate androgen regulated mucin like protein 1 (PARM 1)
  • Length: 310  
  • Mass: 32289
  • Tissue specificity: Widely expressed with highest levels in heart, kidney and placenta. {ECO
• Sequence:

  MVYKTLFALCILTAGWRVQSLPTSAPLSVSLPTNIVPPTTIWTSSPQNTDADTASPSNGTHNNSVLPVTASAPTS
  LLPKNISIESREEEITSPGSNWEGTNTDPSPSGFSSTSGGVHLTTTLEEHSSGTPEAGVAATLSQSAAEPPTLIS
  PQAPASSPSSLSTSPPEVFSASVTTNHSSTVTSTQPTGAPTAPESPTEESSSDHTPTSHATAEPVPQEKTPPTTV
  SGKVMCELIDMETTTTFPRVIMQEVEHALSSGSIAAITVTVIAVVLLVFGVAAYLKIRHSSYGRLLDDHDYGSWG
  NYNNPLYDDS

• Structural information:
  • Interpro: IPR031431  
  • STRING: ENSP00000370224
• Other Databases: GeneCards:  PARM1  Malacards:  PARM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0051973	positive regulation of telomerase activity	ISS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)