• Gene id: 25847

Gene Summary

• Gene Symbol: ANAPC13   Gene   UCSC   Ensembl
• Aliases: APC13, SWM1
• Gene name: anaphase promoting complex subunit 13
• Alternate names: anaphase-promoting complex subunit 13, cyclosome subunit 13,
• Gene location: 3q22.2 (134486022: 134477703)     Exons: 3     NC_000003.12
• Gene summary(Entrez): This gene encodes a component of the anaphase promoting complex, a large ubiquitin-protein ligase that controls cell cycle progression by regulating the degradation of cell cycle regulators such as B-type cyclins. The encoded protein is evolutionarily con
• OMIM: 614484

Protein Summary

• Protein general information: Q9BS18  
  • Name: Anaphase promoting complex subunit 13 (APC13) (Cyclosome subunit 13)
  • Length: 74  
  • Mass: 8521
• Sequence:

  MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN

• Structural information:
  • Interpro: IPR008401  
  • PDB: 4UI9 5G04 5KHR 5KHU 5L9T 5L9U 5LCW 6Q6G 6Q6H
  • PDBsum: 4UI9 5G04 5KHR 5KHU 5L9T 5L9U 5LCW 6Q6G 6Q6H
  • DIP: 56455
  • STRING: ENSP00000421842
• Other Databases: GeneCards:  ANAPC13  Malacards:  ANAPC13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005680	anaphase-promoting complex	IBA	cellular component
GO:0070979	protein K11-linked ubiquitination	IBA	biological process
GO:0070979	protein K11-linked ubiquitination	IDA	biological process
GO:0005680	anaphase-promoting complex	IDA	cellular component
GO:0005680	anaphase-promoting complex	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis
hsa04110	Cell cycle
hsa04114	Oocyte meiosis
hsa04914	Progesterone-mediated oocyte maturation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881