• Gene id: 25843

Gene Summary

• Gene Symbol: MOB4   Gene   UCSC   Ensembl
• Aliases: 2C4D, CGI-95, MOB1, MOB3, MOBKL3, PHOCN, PREI3
• Gene name: MOB family member 4, phocein
• Alternate names: MOB-like protein phocein, MOB1, Mps One Binder kinase activator-like 3, Mps One Binder kinase activator-like 3, class II mMOB1, mob1 homolog 3, phocein, Mob-like protein, preimplantation protein 3,
• Gene location: 2q33.1 (197515553: 197553698)     Exons: 8     NC_000002.12
• Gene summary(Entrez): This gene was identified based on its similarity with the mouse counterpart. Studies of the mouse counterpart suggest that the expression of this gene may be regulated during oocyte maturation and preimplantation following zygotic gene activation. Alterna
• OMIM: 609361

Protein Summary

• Protein general information: Q9Y3A3  
  • Name: MOB like protein phocein (2C4D) (Class II mMOB1) (Mob1 homolog 3) (Mob3) (Mps one binder kinase activator like 3) (Preimplantation protein 3)
  • Length: 225  
  • Mass: 26032
• Sequence:

  MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLR
  QFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKE
  SSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA

• Structural information:
  • Interpro: IPR005301  IPR036703  
  • PDB: 5YF4
  • PDBsum: 5YF4
  • STRING: ENSP00000315702
• Other Databases: GeneCards:  MOB4  Malacards:  MOB4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0019900	kinase binding	IEA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005737	cytoplasm	ISS	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray