• Gene id: 25837

Gene Summary

• Gene Symbol: RAB26   Gene   UCSC   Ensembl
• Aliases: V46133
• Gene name: RAB26, member RAS oncogene family
• Alternate names: ras-related protein Rab-26, Ras-related oncogene protein,
• Gene location: 16p13.3 (2148143: 2154164)     Exons: 11     NC_000016.10
• Gene summary(Entrez): Members of the RAB protein family, including RAB26, are important regulators of vesicular fusion and trafficking. The RAB family of small G proteins regulates intercellular vesicle trafficking, including exocytosis, endocytosis, and recycling (summary by
• OMIM: 605455

Protein Summary

• Protein general information: Q9ULW5  
  • Name: Ras related protein Rab 26
  • Length: 256  
  • Mass: 27900
  • Tissue specificity: Predominantly expressed in brain.
• Sequence:

  MSRKKTPKSKGASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRPSLGGGVDFYDVAFKVMLVGDSGVG
  KTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQMWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKA
  SFDNIQAWLTEIHEYAQHDVALMLLGNKVDSAHERVVKREDGEKLAKEYGLPFMETSAKTGLNVDLAFTAIAKEL
  KQRSMKAPSEPRFRLHDYVKREGRGASCCRP

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  
  • Prosite: PS51419
  • PDB: 2G6B
  • PDBsum: 2G6B
  • STRING: ENSP00000210187
• Other Databases: GeneCards:  RAB26  Malacards:  RAB26

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006886	intracellular protein transport	IBA	biological process
GO:0003924	GTPase activity	IBA	molecular function
GO:0012505	endomembrane system	IBA	cellular component
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0000139	Golgi membrane	IDA	cellular component
GO:0045055	regulated exocytosis	IMP	biological process
GO:0005525	GTP binding	IMP	molecular function
GO:0043001	Golgi to plasma membrane protein transport	IMP	biological process
GO:0035272	exocrine system development	IMP	biological process
GO:0030667	secretory granule membrane	ISS	cellular component
GO:0019002	GMP binding	IMP	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030667	secretory granule membrane	IEA	cellular component
GO:0035272	exocrine system development	IEA	biological process
GO:0031226	intrinsic component of plasma membrane	IEA	cellular component
GO:0017157	regulation of exocytosis	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0030658	transport vesicle membrane	IEA	cellular component
GO:0017157	regulation of exocytosis	ISS	biological process
GO:0005525	GTP binding	ISS	molecular function
GO:0035272	exocrine system development	ISS	biological process
GO:0031226	intrinsic component of plasma membrane	ISS	cellular component
GO:0099575	regulation of protein catabolic process at presynapse, modulating synaptic transmission	IMP	biological process
GO:0099575	regulation of protein catabolic process at presynapse, modulating synaptic transmission	IDA	biological process
GO:0099575	regulation of protein catabolic process at presynapse, modulating synaptic transmission	IDA	biological process
GO:0098993	anchored component of synaptic vesicle membrane	IMP	cellular component
GO:0098993	anchored component of synaptic vesicle membrane	IDA	cellular component
GO:0098993	anchored component of synaptic vesicle membrane	IDA	cellular component
GO:0098993	anchored component of synaptic vesicle membrane	IDA	cellular component
GO:0098993	anchored component of synaptic vesicle membrane	IDA	cellular component
GO:0098993	anchored component of synaptic vesicle membrane	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)