• Gene id: 25830

Gene Summary

• Gene Symbol: SULT4A1   Gene   UCSC   Ensembl
• Aliases: BR-STL-1, BRSTL1, DJ388M5.3, NST, SULTX3, hBR-STL-1
• Gene name: sulfotransferase family 4A member 1
• Alternate names: sulfotransferase 4A1, ST4A1, brain sulfotransferase-like protein, hBR-STL, nervous system cytosolic sulfotransferase, nervous system sulfotransferase, sulfotransferase-related protein,
• Gene location: 22q13.31 (2944970: 2933217)     Exons: 4     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the sulfotransferase family. The encoded protein is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. Polymorphisms in this gene may be associated with susceptibility to schizop
• OMIM: 608359

Protein Summary

• Protein general information: Q9BR01  
  • Name: Sulfotransferase 4A1 (ST4A1) (EC 2.8.2. ) (Brain sulfotransferase like protein) (hBR STL) (hBR STL 1) (Nervous system sulfotransferase) (NST)
  • Length: 284  
  • Mass: 33085
  • Tissue specificity: Highly expressed in the cerebral cortex and frontal lobe, slightly less in the cerebellum, occipital and temporal lobes, relatively low in the medulla and putamen, and lowest in the spinal cord. No expression detected in the pancreas (
• Sequence:

  MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPD
  EIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLR
  TMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEA
  LTEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL

• Structural information:
  • Interpro: IPR027417  IPR000863  
  • PDB: 1ZD1
  • PDBsum: 1ZD1
  • STRING: ENSP00000332565
• Other Databases: GeneCards:  SULT4A1  Malacards:  SULT4A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0008202	steroid metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0006790	sulfur compound metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008146	sulfotransferase activity	NAS	molecular function
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray