• Gene id: 25824

Gene Summary

• Gene Symbol: PRDX5   Gene   UCSC   Ensembl
• Aliases: ACR1, AOEB166, B166, HEL-S-55, PLP, PMP20, PRDX6, PRXV, SBBI10, prx-V
• Gene name: peroxiredoxin 5
• Alternate names: peroxiredoxin-5, mitochondrial, Alu co-repressor 1, TPx type VI, antioxidant enzyme B166, epididymis secretory protein Li 55, liver tissue 2D-page spot 71B, peroxiredoxin V, peroxisomal antioxidant enzyme, thioredoxin peroxidase PMP20, thioredoxin reductase,
• Gene location: 11q13.1 (64318120: 64321810)     Exons: 6     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein interacts with peroxisome receptor 1 and plays an antioxidant protective role in different tissues
• OMIM: 606583

Protein Summary

• Protein general information: P30044  
  • Name: Peroxiredoxin 5, mitochondrial (EC 1.11.1.15) (Alu corepressor 1) (Antioxidant enzyme B166) (AOEB166) (Liver tissue 2D page spot 71B) (PLP) (Peroxiredoxin V) (Prx V) (Peroxisomal antioxidant enzyme) (TPx type VI) (Thioredoxin peroxidase PMP20)
  • Length: 214  
  • Mass: 22086
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MGLAGVCALRRSAGYILVGGAGGQSAAAAARRYSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGNK
  VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLL
  ADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL

• Structural information:
  • Protein Domains: (56..21-)
    (/note="Thioredoxin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00691"-)
  • Interpro: IPR037944  IPR013740  IPR036249  IPR013766  
  • Prosite: PS51352
  • CDD: cd03013
  • PDB: 1H4O 1HD2 1OC3 1URM 2VL2 2VL3 2VL9 3MNG 4K7I 4K7N 4K7O 4MMM
  • PDBsum: 1H4O 1HD2 1OC3 1URM 2VL2 2VL3 2VL9 3MNG 4K7I 4K7N 4K7O 4MMM
  • STRING: ENSP00000265462
• Other Databases: GeneCards:  PRDX5  Malacards:  PRDX5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0005777	peroxisome	IBA	cellular component
GO:0042744	hydrogen peroxide catabolic process	IBA	biological process
GO:0045454	cell redox homeostasis	IBA	biological process
GO:0008379	thioredoxin peroxidase activity	IBA	molecular function
GO:0034599	cellular response to oxidative stress	IBA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004601	peroxidase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0016209	antioxidant activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0008379	thioredoxin peroxidase activity	EXP	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034599	cellular response to oxidative stress	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005782	peroxisomal matrix	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0016480	negative regulation of transcription by RNA polymerase III	IDA	biological process
GO:0005777	peroxisome	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0004601	peroxidase activity	IDA	molecular function
GO:0001016	RNA polymerase III transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0006979	response to oxidative stress	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0034614	cellular response to reactive oxygen species	IMP	biological process
GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IMP	molecular function
GO:0006954	inflammatory response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04146	Peroxisome

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq