• Gene id: 25820

Gene Summary

• Gene Symbol: ARIH1   Gene   UCSC   Ensembl
• Aliases: ARI, HARI, HHARI, UBCH7BP
• Gene name: ariadne RBR E3 ubiquitin protein ligase 1
• Alternate names: E3 ubiquitin-protein ligase ARIH1, ARI-1, H7-AP2, MOP-6, ariadne homolog, ubiquitin-conjugating enzyme E2 binding protein, 1, ariadne, Drosophila, homolog of, monocyte protein 6, protein ariadne-1 homolog, ubcH7-binding protein, ubcM4-interacting protein, ubiquitin,
• Gene location: 15q24.1 (72474329: 72602986)     Exons: 14     NC_000015.10
• OMIM: 605624

Protein Summary

• Protein general information: Q9Y4X5  
  • Name: E3 ubiquitin protein ligase ARIH1 (EC 2.3.2.31) (H7 AP2) (HHARI) (Monocyte protein 6) (MOP 6) (Protein ariadne 1 homolog) (ARI 1) (UbcH7 binding protein) (UbcM4 interacting protein) (Ubiquitin conjugating enzyme E2 binding protein 1)
  • Length: 557  
  • Mass: 64118
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MDSDEGYNYEFDEDEECSEEDSGAEEEEDEDDDEPDDDTLDLGEVELVEPGLGVGGERDGLLCGETGGGGGSALG
  PGGGGGGGGGGGGGGPGHEQEEDYRYEVLTAEQILQHMVECIREVNEVIQNPATITRILLSHFNWDKEKLMERYF
  DGNLEKLFAECHVINPSKKSRTRQMNTRSSAQDMPCQICYLNYPNSYFTGLECGHKFCMQCWSEYLTTKIMEEGM
  GQTISCPAHGCDILVDDNTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKVQYPDAKPVRCKCG
  RQFCFNCGENWHDPVKCKWLKKWIKKCDDDSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVC
  LGPWEPHGSAWYNCNRYNEDDAKAARDAQERSRAALQRYLFYCNRYMNHMQSLRFEHKLYAQVKQKMEEMQQHNM
  SWIEVQFLKKAVDVLCQCRATLMYTYVFAFYLKKNNQSIIFENNQADLENATEVLSGYLERDISQDSLQDIKQKV
  QDKYRYCESRRRVLLQHVHEGYEKDLWEYIED

• Structural information:
  • Interpro: IPR031127  IPR002867  IPR001841  IPR013083  
  • Prosite: PS51873 PS50089
  • PDB: 1WD2 2M9Y 4KBL 4KC9 5TTE 5UDH
  • PDBsum: 1WD2 2M9Y 4KBL 4KC9 5TTE 5UDH
  • DIP: 53626
  • STRING: ENSP00000369217
• Other Databases: GeneCards:  ARIH1  Malacards:  ARIH1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000151	ubiquitin ligase complex	IBA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0031624	ubiquitin conjugating enzyme binding	IBA	molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0016567	protein ubiquitination	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0031463	Cul3-RING ubiquitin ligase complex	IDA	colocalizes with
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0031463	Cul3-RING ubiquitin ligase complex	IDA	colocalizes with
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0097413	Lewy body	IDA	cellular component
GO:0031464	Cul4A-RING E3 ubiquitin ligase complex	IDA	colocalizes with
GO:0031462	Cul2-RING ubiquitin ligase complex	IDA	colocalizes with
GO:0019005	SCF ubiquitin ligase complex	IDA	colocalizes with
GO:0016567	protein ubiquitination	IDA	biological process
GO:0031462	Cul2-RING ubiquitin ligase complex	IDA	NOT|colocalizes with
GO:0019005	SCF ubiquitin ligase complex	IDA	colocalizes with
GO:0016567	protein ubiquitination	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031624	ubiquitin conjugating enzyme binding	IPI	molecular function
GO:0031624	ubiquitin conjugating enzyme binding	IPI	molecular function
GO:0031624	ubiquitin conjugating enzyme binding	IPI	molecular function
GO:0004842	ubiquitin-protein transferase activity	IEA	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0015030	Cajal body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0000151	ubiquitin ligase complex	TAS	cellular component
GO:0019787	ubiquitin-like protein transferase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray