• Gene id: 25818

Gene Summary

• Gene Symbol: KLK5   Gene   UCSC   Ensembl
• Aliases: KLK-L2, KLKL2, SCTE
• Gene name: kallikrein related peptidase 5
• Alternate names: kallikrein-5, kallikrein-like protein 2, stratum corneum tryptic enzyme,
• Gene location: 19q13.41 (50953037: 50943298)     Exons: 7     NC_000019.10
• Gene summary(Entrez): Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one

Protein Summary

• Protein general information: Q9Y337  
  • Name: Kallikrein 5 (EC 3.4.21. ) (Kallikrein like protein 2) (KLK L2) (Stratum corneum tryptic enzyme)
  • Length: 293  
  • Mass: 32020
  • Tissue specificity: Expressed in skin, breast, brain and testis. Expressed at the stratum granulosum of palmar skin. {ECO
• Sequence:

  MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDM
  HTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGH
  SNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQI
  DDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS

• Structural information:
  • Protein Domains: (67..29-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR009003  IPR001314  IPR001254  IPR018114  IPR033116  
  • Prosite: PS50240 PS00134 PS00135
  • CDD: cd00190
  • PDB: 2PSX 2PSY 6QFE
  • PDBsum: 2PSX 2PSY 6QFE
  • STRING: ENSP00000337733
• Other Databases: GeneCards:  KLK5  Malacards:  KLK5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022617	extracellular matrix disassembly	IBA	biological process
GO:0030141	secretory granule	IBA	cellular component
GO:0002803	positive regulation of antibacterial peptide production	IBA	biological process
GO:0097186	amelogenesis	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	TAS	molecular function
GO:0008233	peptidase activity	TAS	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0008544	epidermis development	TAS	biological process
GO:0004252	serine-type endopeptidase activity	EXP	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0070268	cornification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0045745	positive regulation of G protein-coupled receptor signaling pathway	IDA	biological process
GO:0097209	epidermal lamellar body	IDA	cellular component
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0004252	serine-type endopeptidase activity	NAS	molecular function
GO:0008233	peptidase activity	IMP	molecular function
GO:0005615	extracellular space	IMP	cellular component
GO:0002803	positive regulation of antibacterial peptide production	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R