• Gene id: 25817

Gene Summary

• Gene Symbol: TAFA5   Gene   UCSC   Ensembl
• Aliases: FAM19A5, QLLK5208, TAFA-5, UNQ5208
• Gene name: TAFA chemokine like family member 5
• Alternate names: chemokine-like protein TAFA-5, TAFA protein 5, family with sequence similarity 19 (chemokine (C-C motif)-like), member A5, family with sequence similarity 19 member A5, C-C motif chemokine like, protein FAM19A5,
• Gene location: 22q13.32 (48489552: 48751931)     Exons: 13     NC_000022.11
• Gene summary(Entrez): This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the
• OMIM: 617499

Protein Summary

• Protein general information: Q7Z5A7  
  • Name: Chemokine like protein TAFA 5
  • Length: 132  
  • Mass: 14301
  • Tissue specificity: Expressed in the subcutaneous and perirenal adipose tissue (at protein level) (PubMed
• Sequence:

  MAPSPRTGSRQDATALPSMSSTFWAFMILASLLIAYCSQLAAGTCEIVTLDRDSSQPRRTIARQTARCACRKGQI
  AGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS

• Structural information:
  • Interpro: IPR020350  IPR040329  
  • STRING: ENSP00000383933
• Other Databases: GeneCards:  TAFA5  Malacards:  TAFA5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R