• Gene id: 25816

Gene Summary

• Gene Symbol: TNFAIP8   Gene   UCSC   Ensembl
• Aliases: GG2-1, MDC-3.13, NDED, SCC-S2, SCCS2
• Gene name: TNF alpha induced protein 8
• Alternate names: tumor necrosis factor alpha-induced protein 8, NF-kappa-B-inducible DED-containing protein, TNF-induced protein GG2-1, head and neck tumor and metastasis-related protein, tumor necrosis factor, alpha induced protein 8,
• Gene location: 5q23.1 (119207570: 119459744)     Exons: 16     NC_000010.11
• OMIM: 612111

Protein Summary

• Protein general information: O95379  
  • Name: Tumor necrosis factor alpha induced protein 8 (TNF alpha induced protein 8) (Head and neck tumor and metastasis related protein) (MDC 3.13) (NF kappa B inducible DED containing protein) (NDED) (SCC S2) (TNF induced protein GG2 1)
  • Length: 198  
  • Mass: 23003
  • Tissue specificity: Expressed at high levels in the spleen, lymph node, thymus, thyroid, bone marrow and placenta. Expressed at high levels both in various tumor tissues, unstimulated and cytokine-activated cultured cells. Expressed at low levels in the s
• Sequence:

  MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNL
  IKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAK
  SHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI

• Structural information:
  • Interpro: IPR008477  IPR038355  
  • STRING: ENSP00000427424
• Other Databases: GeneCards:  TNFAIP8  Malacards:  TNFAIP8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IBA	molecular function
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IMP	molecular function
GO:0043065	positive regulation of apoptotic process	IMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)