• Gene id: 25804

Gene Summary

• Gene Symbol: LSM4   Gene   UCSC   Ensembl
• Aliases: GRP, YER112W
• Gene name: LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated
• Alternate names: U6 snRNA-associated Sm-like protein LSm4, LSM4 U6 small nuclear RNA and mRNA degradation associated, LSM4 homolog, U6 small nuclear RNA associated, glycine-rich protein,
• Gene location: 19p13.11 (18323075: 18306235)     Exons: 5     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Alt
• OMIM: 610495

Protein Summary

• Protein general information: Q9Y4Z0  
  • Name: U6 snRNA associated Sm like protein LSm4 (Glycine rich protein) (GRP)
  • Length: 139  
  • Mass: 15350
• Sequence:

  MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEI
  IDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ

• Structural information:
  • Interpro: IPR034101  IPR027141  IPR001163  IPR010920  
  • CDD: cd01723
  • PDB: 3JCR 5O9Z 6AH0 6AHD 6QW6 6QX9
  • PDBsum: 3JCR 5O9Z 6AH0 6AHD 6QW6 6QX9
  • DIP: 31209
  • STRING: ENSP00000469468
• Other Databases: GeneCards:  LSM4  Malacards:  LSM4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0097526	spliceosomal tri-snRNP complex	IBA	cellular component
GO:0017070	U6 snRNA binding	IBA	molecular function
GO:0005688	U6 snRNP	IBA	cellular component
GO:0000932	P-body	IBA	cellular component
GO:0000387	spliceosomal snRNP assembly	IBA	biological process
GO:0033962	cytoplasmic mRNA processing body assembly	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0120115	Lsm2-8 complex	IDA	cellular component
GO:0071005	U2-type precatalytic spliceosome	IDA	cellular component
GO:0046540	U4/U6 x U5 tri-snRNP complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000398	mRNA splicing, via spliceosome	IEA	biological process
GO:0006396	RNA processing	IEA	biological process
GO:0000956	nuclear-transcribed mRNA catabolic process	IEA	biological process
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0008380	RNA splicing	TAS	biological process
GO:0005688	U6 snRNP	TAS	cellular component
GO:0043928	exonucleolytic catabolism of deadenylated mRNA	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0042731	PH domain binding	IDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome
hsa03018	RNA degradation

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq