• Gene id: 258010

Gene Summary

• Gene Symbol: SVIP   Gene   UCSC   Ensembl
• Gene name: small VCP interacting protein
• Alternate names: small VCP/p97-interacting protein,
• Gene location: 11p14.3 (: )     Exons:     
• Gene summary(Entrez): Endoplasmic reticulum-associated degradation (ERAD) is the pathway by which misfolded proteins in the endoplasmic reticulum are targeted to the proteasome for degradation. Multiple specialized proteins interact with one another during ERAD to complete thi
• OMIM: 0

Protein Summary

• Protein general information: Q8NHG7  
  • Name: Small VCP/p97 interacting protein
  • Length: 77  
  • Mass: 8443
• Sequence:

  MGLCFPCPGESAPPTPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQIATSGPPPEGGLRWT
  VS

• Structural information:
  • Interpro: IPR031632  
  • STRING: ENSP00000346130
• Other Databases: GeneCards:  SVIP  Malacards:  SVIP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1904153	negative regulation of retrograde protein transport, ER to cytosol	IMP	biological process
GO:0031225	anchored component of membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:1904240	negative regulation of VCP-NPL4-UFD1 AAA ATPase complex assembly	IEA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0030868	smooth endoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0043621	protein self-association	IMP	molecular function
GO:0010508	positive regulation of autophagy	IMP	biological process
GO:1903070	negative regulation of ER-associated ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0031333	negative regulation of protein-containing complex assembly	IMP	biological process
GO:1903061	positive regulation of protein lipidation	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)